@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu23490: (2016-07-06 )
MKDRIERAAAFIKQNLPESPKIGLILGSGLGILADEIENPVKLKYEDIPEFPVSTVEGHAGQLVLGTLEGVSVIAMQGRFHFYEGYSMEKVTFPVRVMKALGVEALIVTNAAGGVNTEFRAGDLMIITDHINFMGTNPLIGPNEADFGARFPDMSSAYDKDLSSLAEKIAKDLNIPIQKGVYTAVTGPSYETPAEVRFLRTMGSDAVGMSTVPEVIVANHAGMRVLGISCISNAAAGILDQPLSHDEVMEVTEKVKAGFLKLVKAIVAQYE

Atome Classification :

(75 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

P1G_A_5(2AI1)
PNPH_BOVIN
[Raw transfer]




P1D_A_5(2AI2)
PNPH_BOVIN
[Raw transfer]




IMG_A_4(1B8N)
PNPH_BOVIN
[Raw transfer]




NOS_G_7(1A9S)
PNPH_BOVIN
[Raw transfer]




P2G_A_5(2AI3)
PNPH_BOVIN
[Raw transfer]




9DI_G_7(1A9P)
PNPH_BOVIN
[Raw transfer]




NOS_E_5(1RCT)
PNPH_HUMAN
[Raw transfer]




IMH_A_4(1B8O)
PNPH_BOVIN
[Raw transfer]




IMH_M_13(1RT9)
PNPH_HUMAN
[Raw transfer]




GMP_M_13(1RFG)
PNPH_HUMAN
[Raw transfer]




DIH_J_10(2A0X)
PNPH_HUMAN
[Raw transfer]




IMH_G_7(2OC9)
PNPH_HUMAN
[Raw transfer]




IM5_C_10(4EB8)
PNPH_HUMAN
[Raw transfer]




IMH_G_7(1G2O)
PUNA_MYCTU
[Raw transfer]




DIH_J_10(2A0Y)
PNPH_HUMAN
[Raw transfer]




DIH_M_13(1RSZ)
PNPH_HUMAN
[Raw transfer]




DIH_A_8(2P4S)
?
[Raw transfer]




IM5_B_7(4EB8)
PNPH_HUMAN
[Raw transfer]




IM5_A_5(4EB8)
PNPH_HUMAN
[Raw transfer]




IMH_M_13(1RR6)
PNPH_HUMAN
[Raw transfer]




DIH_J_10(2A0W)
PNPH_HUMAN
[Raw transfer]




IMH_G_7(2OC4)
PNPH_HUMAN
[Raw transfer]




HA1_A_4(1V48)
PNPH_BOVIN
[Raw transfer]




DIH_A_5(3BGS)
PNPH_HUMAN
[Raw transfer]




3DG_M_13(1V45)
PNPH_HUMAN
[Raw transfer]




IMH_D_4(2ON6)
PNPH_HUMAN
[Raw transfer]




22A_A_2(3K8Q)
PNPH_HUMAN
[Raw transfer]




MSG_E_5(1YRY)
PNPH_HUMAN
[Raw transfer]




IMH_E_3(2Q7O)
PNPH_HUMAN
[Raw transfer]




IMH_M_13(1PF7)
PNPH_HUMAN
[Raw transfer]




IM5_B_6(4EAR)
PNPH_HUMAN
[Raw transfer]




IM5_A_4(4EAR)
PNPH_HUMAN
[Raw transfer]




IM5_C_8(4EAR)
PNPH_HUMAN
[Raw transfer]




2DI_M_13(1V3Q)
PNPH_HUMAN
[Raw transfer]




GUN_P_16(1V2H)
PNPH_HUMAN
[Raw transfer]




AC2_M_13(1PWY)
PNPH_HUMAN
[Raw transfer]




HPA_A_2(3LBA)
?
[Raw transfer]




HPA_G_7(1A9R)
PNPH_BOVIN
[Raw transfer]




HPA_A_2(4UC0)
?
[Raw transfer]




HPA_A_4(1VFN)
PNPH_BOVIN
[Raw transfer]




R1P_D_4(1A9T)
PNPH_BOVIN
[Raw transfer]




HPA_G_7(1A9Q)
PNPH_BOVIN
[Raw transfer]




GU7_A_5(1FXU)
PNPH_BOVIN
[Raw transfer]




GUN_J_10(1ULB)
PNPH_HUMAN
[Raw transfer]




AZG_P_16(1V41)
PNPH_HUMAN
[Raw transfer]




7DG_A_5(3INY)
PNPH_HUMAN
[Raw transfer]




ADE_A_4(4LNA)
?
[Raw transfer]




ADE_A_4(4NSN)
?
[Raw transfer]




BTY_A_4(2QPL)
PNPH_BOVIN
[Raw transfer]




2FD_C_6(3GGS)
PNPH_HUMAN
[Raw transfer]




2FD_A_4(3GGS)
PNPH_HUMAN
[Raw transfer]




ADE_A_4(4NSN)
?
[Raw transfer]




DA_A_5(4NS1)
?
[Raw transfer]




TRS_D_12(3KHS)
?
[Raw transfer]




2FD_B_5(3GGS)
PNPH_HUMAN
[Raw transfer]




TRS_B_8(3KHS)
?
[Raw transfer]




TRS_C_10(3KHS)
?
[Raw transfer]




9D9_A_4(3FUC)
PNPH_BOVIN
[Raw transfer]




9D9_B_7(3FUC)
PNPH_BOVIN
[Raw transfer]




9D9_C_9(3FUC)
PNPH_BOVIN
[Raw transfer]




9D9_A_4(3FUC)
PNPH_BOVIN
[Raw transfer]




D1V_A_5(3D1V)
PNPH_HUMAN
[Raw transfer]




NDS_G_7(1TCV)
?
[Raw transfer]




A2F_A_4(3GB9)
PNPH_HUMAN
[Raw transfer]




A2F_C_6(3GB9)
PNPH_HUMAN
[Raw transfer]




2 PsiBlast_PDB 94.5856%-129 - C3 -3LBA 3.4 ?
104 HHSearch 93.8751%-126 - C3 -4M1E - ? -
111 HHSearch 93.5746%-102 - C3 -2P4S 4.9 ?
4 PsiBlast_PDB 93.4249%-104 - C3 -4NSN 3.4 ?
3 PsiBlast_PDB 92.9849%-110 - C3 -4NS1 3.4 ?
101 HHSearch 92.6452%-111 - C3 -4NSN 3.5 ?
44 PsiBlast_CBE 90.9447% -79 - C3 -3K8O - PNPH_HUMAN -
107 HHSearch 90.8857%-142 - C3 -3LA8 - ? -
102 HHSearch 90.7848% -90 - C3 -3FUC 4.3 PNPH_BOVIN
69 PsiBlast_CBE 90.3847% -82 - C3 -3PHB - PNPH_HUMAN -
66 PsiBlast_CBE 90.2747% -78 - C3 -3PHB - PNPH_HUMAN -
46 PsiBlast_CBE 90.0447% -77 - C3 -3K8O - PNPH_HUMAN -
41 PsiBlast_CBE 89.8647% -85 - C3 -3K8O - PNPH_HUMAN -
43 PsiBlast_CBE 89.8247% -81 - C3 -3K8O - PNPH_HUMAN -
108 HHSearch 89.8049% -86 - C3 -4LNA 3.4 ?
18 PsiBlast_PDB 89.7948% -74 - C3 -1B8N 6.1 PNPH_BOVIN
1 PsiBlast_PDB 89.5956%-140 - C3 -3LA8 - ? -
15 PsiBlast_PDB 89.5248% -90 - C3 -2AI1 8.5 PNPH_BOVIN
67 PsiBlast_CBE 89.4947% -78 - C3 -3PHB - PNPH_HUMAN -
37 PsiBlast_CBE 89.3848% -75 - C3 -1A9T 4.7 PNPH_BOVIN
7 PsiBlast_PDB 89.2148% -76 - C3 -1FXU 4.5 PNPH_BOVIN
97 PsiBlast_CBE 89.0646% -96 - C3 -3GGS 4.0 PNPH_HUMAN
17 PsiBlast_PDB 89.0348% -89 - C3 -2AI3 7.1 PNPH_BOVIN
19 PsiBlast_PDB 88.9448% -75 - C3 -1B8O 6.0 PNPH_BOVIN
57 PsiBlast_CBE 88.8947% -87 - C3 -1PF7 3.5 PNPH_HUMAN
12 PsiBlast_PDB 88.7148% -78 - C3 -1A9P 5.5 PNPH_BOVIN
16 PsiBlast_PDB 88.5848% -83 - C3 -2AI2 7.8 PNPH_BOVIN
49 PsiBlast_CBE 88.5347% -78 - C3 -3BGS 4.3 PNPH_HUMAN
55 PsiBlast_CBE 88.5047% -80 - C3 -1RSZ 4.8 PNPH_HUMAN
5 PsiBlast_PDB 88.5048% -78 - C3 -1A9Q 3.1 PNPH_BOVIN
60 PsiBlast_CBE 88.4747% -89 - C3 -1V3Q 4.1 PNPH_HUMAN
56 PsiBlast_CBE 88.3947% -79 - C3 -1RR6 5.1 PNPH_HUMAN
13 PsiBlast_PDB 88.3648% -73 - C3 -1A9S 5.8 PNPH_BOVIN
59 PsiBlast_CBE 88.3547% -90 - C3 -1V41 3.5 PNPH_HUMAN
98 PsiBlast_CBE 88.2846% -93 - C3 -3GGS 4.0 PNPH_HUMAN
61 PsiBlast_CBE 88.2247% -91 - C3 -1V2H 3.5 PNPH_HUMAN
54 PsiBlast_CBE 88.1847% -78 - C3 -1RT9 5.5 PNPH_HUMAN
47 PsiBlast_CBE 88.0747% -96 - C3 -3INY 3.8 PNPH_HUMAN
10 PsiBlast_PDB 88.0248% -99 - C3 -1VFN 3.0 PNPH_BOVIN
6 PsiBlast_PDB 87.9948% -77 - C3 -1A9R 3.3 PNPH_BOVIN
36 PsiBlast_CBE 87.9648% -85 - C3 -3FUC 4.4 PNPH_BOVIN
58 PsiBlast_CBE 87.8347% -81 - C3 -1V45 4.2 PNPH_HUMAN
50 PsiBlast_CBE 87.7347% -84 - C3 -2Q7O 4.5 PNPH_HUMAN
35 PsiBlast_CBE 87.7148% -83 - C3 -3FUC 4.5 PNPH_BOVIN
20 PsiBlast_PDB 87.6548% -84 - C3 -3FUC 4.3 PNPH_BOVIN
48 PsiBlast_CBE 87.6047% -81 - C3 -3D1V 2.8 PNPH_HUMAN
100 PsiBlast_CBE 87.5046% -92 - C3 -3GB9 3.9 PNPH_HUMAN
96 PsiBlast_CBE 87.3546% -94 - C3 -3GGS 4.6 PNPH_HUMAN
63 PsiBlast_CBE 87.3447% -83 - C3 -1RCT 3.8 PNPH_HUMAN
62 PsiBlast_CBE 87.3247% -88 - C3 -1RFG 3.7 PNPH_HUMAN
51 PsiBlast_CBE 87.2447% -86 - C3 -1YRY 3.5 PNPH_HUMAN
40 PsiBlast_CBE 87.0247% -80 - C3 -3K8Q 4.2 PNPH_HUMAN
23 PsiBlast_CBE 86.9747% -85 - C3 -3KHS 2.5 ?
64 PsiBlast_CBE 86.9547% -85 - C3 -1PWY 4.1 PNPH_HUMAN
21 PsiBlast_CBE 86.9447% -90 - C3 -3KHS 2.5 ?
52 PsiBlast_CBE 86.7847% -91 - C3 -1ULB 4.1 PNPH_HUMAN
22 PsiBlast_CBE 86.4347% -83 - C3 -3KHS 2.4 ?
99 PsiBlast_CBE 85.6646%-109 * C3 *3GB9 3.7 PNPH_HUMAN
38 PsiBlast_CBE 85.4848% -86 - C3 -2QPL 3.6 PNPH_BOVIN
14 PsiBlast_PDB 85.4148%-105 - C3 -1V48 7.1 PNPH_BOVIN
93 PsiBlast_CBE 84.7852%-107 - C3 -4EB8 4.7 PNPH_HUMAN
80 PsiBlast_CBE 84.3552%-113 - C3 -4EAR 4.5 PNPH_HUMAN
94 PsiBlast_CBE 83.9952%-106 - C3 -4EB8 4.7 PNPH_HUMAN
113 HHSearch 83.9843% -98 - C3 -1TCV 2.8 ?
75 PsiBlast_CBE 83.7152%-108 - C3 -2A0Y 4.2 PNPH_HUMAN
78 PsiBlast_CBE 83.6352%-112 - C3 -4EAR 4.5 PNPH_HUMAN
79 PsiBlast_CBE 83.0152%-114 - C3 -4EAR 4.6 PNPH_HUMAN
95 PsiBlast_CBE 82.9652%-105 - C3 -4EB8 4.9 PNPH_HUMAN
76 PsiBlast_CBE 82.8052%-113 - C3 -2ON6 4.5 PNPH_HUMAN
77 PsiBlast_CBE 82.4752%-106 - C3 -2A0X 4.0 PNPH_HUMAN
73 PsiBlast_CBE 82.0552%-106 - C3 -2A0W 4.1 PNPH_HUMAN
72 PsiBlast_CBE 81.2152%-110 - C3 -2OC9 4.7 PNPH_HUMAN
74 PsiBlast_CBE 81.1952%-110 - C3 -2OC4 4.7 PNPH_HUMAN
112 HHSearch 78.5138% -46 - C3 -1G2O 6.1 PUNA_MYCTU
109 HHSearch 73.8641% -55 - C3 -4UC0 3.3 ?