@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu23610: (2016-07-06 )
MKSLEEKTIAKEQIFSGKVIDLYVEDVELPNGKASKREIVKHPGAVAVLAVTDEGKIIMVKQFRKPLERTIVEIPAGKLEKGEEPEYTALRELEEETGYTAKKLTKITAFYTSPGFADEIVHVFLAEELSVLEEKRELDEDEFVEVMEVTLEDALKLVESREVYDAKTAYAIQYLQLKEALQAQK

Atome Classification :

(30 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

APR_C_3(1V8L)
?
[Raw transfer]




APR_A_2(1V8M)
?
[Raw transfer]




ADV_A_5(1MQW)
?
[Raw transfer]




8GD_B_4(3AC9)
NUDT5_HUMAN
[Raw transfer]




APR_A_2(1MQE)
?
[Raw transfer]




AMP_A_9(2DSD)
NUDT5_HUMAN
[Raw transfer]




R5P_A_2(1V8T)
?
[Raw transfer]




APR_A_4(1V8R)
?
[Raw transfer]




8DD_B_9(3ACA)
NUDT5_HUMAN
[Raw transfer]




GOL_B_18(5C7Q)
?
[Raw transfer]




AMP_A_3(1V8S)
?
[Raw transfer]




GOL_B_16(5C7T)
?
[Raw transfer]




GLC_B_12(5C8L)
?
[Raw transfer]




APR_C_3(1MK1)
?
[Raw transfer]




AMP_B_10(2DSD)
NUDT5_HUMAN
[Raw transfer]




EDO_A_4(2B0V)
?
[Raw transfer]




8OG_A_3(3L85)
NUDT5_HUMAN
[Raw transfer]




APR_A_4(1V8Y)
?
[Raw transfer]




APR_A_4(1V8Y)
?
[Raw transfer]




8GD_A_3(3AC9)
NUDT5_HUMAN
[Raw transfer]




PG0_A_12(5C7Q)
?
[Raw transfer]




1 PsiBlast_PDB 80.0538% -79 * C2 *5C7Q - ? -
23 PsiBlast_CBE 79.7337% -84 - C2 -5C7T 3.4 ?
22 PsiBlast_CBE 79.3937% -86 - C2 -5C8L 2.2 ?
2 PsiBlast_PDB 79.3837% -83 - C2 -5C7T - ? -
3 PsiBlast_PDB 78.2337% -83 - C2 -5C8L - ? -
21 PsiBlast_CBE 77.8738% -79 - C2 -5C7Q 3.2 ?
127 Fugue 77.0333% -75 - C2 -1MQE 4.6 ?
108 HHSearch 73.7336% -18 - C2 -5C7Q 2.2 ?
114 HHSearch 69.0836%-112 - C2 -1V8Y 4.7 ?
39 PsiBlast_CBE 68.9931% 52 - C2 -1KHZ - ADPP_ECOLI -
14 PsiBlast_PDB 68.1838%-104 - C2 -1V8T 2.2 ?
15 PsiBlast_PDB 67.9138%-105 - C2 -1V8R 4.0 ?
41 PsiBlast_CBE 67.7431% 61 - C2 -1GA7 - ADPP_ECOLI -
17 PsiBlast_PDB 67.6837%-100 - C2 -1V8W - ? -
13 PsiBlast_PDB 67.5438%-102 - C2 -1V8S 3.5 ?
43 PsiBlast_CBE 66.9031% 57 - C2 -1G9Q - ADPP_ECOLI -
9 PsiBlast_PDB 66.3138%-108 - C2 -1V8I - ? -
18 PsiBlast_PDB 66.1237%-103 - C2 -1V8V - ? -
12 PsiBlast_PDB 66.0638%-109 - C2 -1V8N - ? -
110 HHSearch 65.9131% -29 - C2 -1MK1 4.6 ?
11 PsiBlast_PDB 65.2738% -88 - C2 -1V8M 4.4 ?
19 PsiBlast_PDB 64.9637%-107 - C2 -1V8Y 4.7 ?
7 PsiBlast_PDB 64.8841% -54 - C2 -1MQW 3.1 ?
10 PsiBlast_PDB 63.9838% -95 - C2 -1V8L 4.6 ?
29 PsiBlast_CBE 58.8832% 55 - C2 -2DSD 5.2 NUDT5_HUMAN
30 PsiBlast_CBE 58.6532% 59 - C2 -2DSD 5.3 NUDT5_HUMAN
38 PsiBlast_CBE 58.1832% 61 - C2 -3AC9 4.7 NUDT5_HUMAN
35 PsiBlast_CBE 57.7132% 63 - C2 -3L85 5.3 NUDT5_HUMAN
33 PsiBlast_CBE 57.6432% 58 - C2 -3ACA 4.8 NUDT5_HUMAN
37 PsiBlast_CBE 56.6232% 60 - C2 -3AC9 5.3 NUDT5_HUMAN