@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu23620: (2016-07-06 )
MRKRKLGTSDLDISEVGLGCMSLGTEKNKALSILDEAIELGINYLDTADLYDRGRNEEIVGDAIQNRRHDIILATKAGNRWDDGSEGWYWDPSKAYIKEAVKKSLTRLKTDYIDLYQLHGGTIEDNIDETIEAFEELKQEGVIRYYGISSIRPNVIKEYVKKSNIVSIMMQFSLFDRRPEEWLPLLEEHQISVVARGPVAKGLLTEKPLDQASESMKQNGYLSYSFEELTNARKAMEEVAPDLSMTEKSLQYLLAQPAVASVITGASKIEQLRENIQAANARRLTEEEIKALQSHTKQDIYKAHRS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_17(1YNP)
?
[Raw transfer]




GOL_A_17(1YNP)
?
[Raw transfer]




GOL_B_19(1YNQ)
?
[Raw transfer]




NDP_B_16(1YNQ)
?
[Raw transfer]




2 PsiBlast_PDB 96.4263%-109 - C3 -1YNQ - ? -
21 PsiBlast_CBE 96.2763% -96 - C3 -1YNQ 11.0 ?
22 PsiBlast_CBE 95.4763% -95 - C3 -1YNP - ? -
1 PsiBlast_PDB 94.2563%-116 - C3 -1YNP 2.6 ?
43 HHSearch 87.3864% -89 - C3 -1YNP 2.6 ?
52 HHSearch 59.0929% 32 - C3 -3N6Q - GPR_ECOLI -
57 HHSearch 59.0728% 4 - C3 -4WGH - ? -
45 HHSearch 58.9230% 59 - C3 -1LQA - TAS_ECOLI -
50 HHSearch 58.7432% 50 - C3 -1PYF - IOLS_BACSU -
54 HHSearch 58.1226% 33 - C3 -3ERP - ? -
4 PsiBlast_PDB 57.7330% 61 - C3 -1PZ0 - IOLS_BACSU -
3 PsiBlast_PDB 57.3130% 61 - C3 -1PYF - IOLS_BACSU -
12 PsiBlast_PDB 56.4227% -8 - C3 -4WGH - ? -
56 HHSearch 55.9128% 22 - C3 -5C7H - ? -
49 HHSearch 55.0029% 57 - C3 -3N2T - ? -
58 HHSearch 54.9526% -3 - C3 -4Q3M - ? -
11 PsiBlast_PDB 54.7526% 61 - C3 -3ERP - ? -
48 HHSearch 54.6130% 61 - C3 -1PZ1 - GS69_BACSU -
9 PsiBlast_PDB 54.5029% 41 - C3 -3N6Q - GPR_ECOLI -
8 PsiBlast_PDB 54.1429% 45 - C3 -4AUB - GPR_ECOLI -