@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu23800: (2016-07-07 )
MKKIGFVGAGSMAEAMINGILQSGITKPEHIYITNRSNDERLIELKETYSVRPCRDKNEFFTHTDIIILAFKPKDAAESIDSIRPYIKDQLVISVLAGLTIETIQHYFGRKLAVIRVMPNTSAAIRKSATGFSVSTEASKNDIIAAKALLETIGDATLVEERHLDAVTAIAGSGPAYVYRYIEAMEKAAQKVGLDKETAKALILQTMAGATDMLLQSGKQPEKLRKEITSPGGTTEAGLRALQDSRFEEAIIHCIEETAKRSAEIKEQFAGAALERHS

Atome Classification :

(26 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PRO_B_13(2AMF)
?
[Raw transfer]




NAP_A_2(2AG8)
?
[Raw transfer]




PRO_A_14(2AMF)
?
[Raw transfer]




PRO_D_11(2AMF)
?
[Raw transfer]




PRO_C_12(2AMF)
?
[Raw transfer]




PRO_E_15(2AMF)
?
[Raw transfer]




5 PsiBlast_PDB 89.6831% -84 - C4 -3TRI - ? -
49 PsiBlast_CBE 89.3133% -72 - C4 -5BSE - ? -
48 PsiBlast_CBE 89.1233% -73 - C4 -5BSE - ? -
50 PsiBlast_CBE 89.0133% -72 - C4 -5BSE - ? -
53 PsiBlast_CBE 88.9033% -73 - C4 -5BSE - ? -
22 PsiBlast_CBE 88.8833% -76 - C4 -5BSH - ? -
51 PsiBlast_CBE 88.6433% -73 - C4 -5BSE - ? -
45 PsiBlast_CBE 88.6333% -70 - C4 -5BSF - ? -
44 PsiBlast_CBE 88.5633% -72 - C4 -5BSF - ? -
26 PsiBlast_CBE 88.5333% -73 - C4 -5BSH - ? -
55 PsiBlast_CBE 88.5133% -71 - C4 -5BSE - ? -
21 PsiBlast_CBE 88.3933% -76 - C4 -5BSH - ? -
36 PsiBlast_CBE 88.3433% -71 - C4 -5BSG - ? -
37 PsiBlast_CBE 88.3333% -70 - C4 -5BSG - ? -
35 PsiBlast_CBE 88.1533% -73 - C4 -5BSG - ? -
54 PsiBlast_CBE 88.1433% -73 - C4 -5BSE - ? -
23 PsiBlast_CBE 88.0133% -75 - C4 -5BSH - ? -
28 PsiBlast_CBE 87.9933% -76 - C4 -5BSH - ? -
39 PsiBlast_CBE 87.9833% -71 - C4 -5BSF - ? -
3 PsiBlast_PDB 87.9633% -71 - C4 -5BSG - ? -
69 PsiBlast_CBE 84.5931%-136 - C4 -2AMF 3.7 ?
71 PsiBlast_CBE 84.4831%-133 - C4 -2AMF 3.8 ?
70 PsiBlast_CBE 83.9331%-137 - C4 -2AMF 3.7 ?
11 PsiBlast_PDB 83.6131%-139 - C4 -2AMF 3.7 ?
72 PsiBlast_CBE 83.5331%-134 - C4 -2AMF 3.8 ?
13 PsiBlast_PDB 79.2835% -81 - C4 -2AG8 3.4 ?