@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu23870: (2016-07-07 )
MPGKSRIIFHIDMNSFYASVEMAYDPALRGKPVAVAGNVKERKGIVVTCSYEARARGVKTTMPVWQAKRHCPELIVLPPNFDRYRNSSRAMFTILREYTDLVEPVSIDEGYMDMTDTPYSSRALETAKEIQSRLQKELLLPSSIGIAPNKFLAKMASDMKKPLGITILRKRQVPDILWPLPVGEMHGVGKKTAEKLKGLGIHTIGELAAADEHSLKRLLGINGPRLKNKANGIHHAPVDPERIYEFKSVGNSSTLSHDSSDEEELLGVFRKLAASVSDRLQRKEVMASKLFIMIRYADWRTITRSTTLRNPIDQKNDILKEAEHLFFKHWNKNPVRLLGITGTDLVEKEQAYKQLDLFSFNEDAKDEPIQQMMEKLNKKYGTKLIRKGATLKKEESKTKGTSFNKDFFQDEKKS

Atome Classification :

(75 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

1FZ_B_9(4R8U)
?
[Raw transfer]




0KX_A_10(4IRC)
DPO4_ECOLI
[Raw transfer]




DCP_B_7(4IRK)
DPO4_ECOLI
[Raw transfer]




XG4_A_10(4IR9)
DPO4_ECOLI
[Raw transfer]




XG4_F_7(4IR9)
DPO4_ECOLI
[Raw transfer]




0KX_A_7(4Q43)
DPO4_ECOLI
[Raw transfer]




DZ4_F_7(4IRD)
DPO4_ECOLI
[Raw transfer]




DZ4_A_10(4IRD)
DPO4_ECOLI
[Raw transfer]




1FZ_A_10(4IR1)
DPO4_ECOLI
[Raw transfer]




ATP_B_12(1N56)
DPO4_SULSO
[Raw transfer]




DCP_A_9(4IRK)
DPO4_ECOLI
[Raw transfer]




1FZ_F_7(4IR1)
DPO4_ECOLI
[Raw transfer]




0KX_F_10(4Q43)
DPO4_ECOLI
[Raw transfer]




DCP_A_7(1S0N)
DPO4_SULSO
[Raw transfer]




1FZ_A_7(4Q44)
DPO4_ECOLI
[Raw transfer]




1FZ_F_10(4Q44)
DPO4_ECOLI
[Raw transfer]




0KX_F_7(4IRC)
DPO4_ECOLI
[Raw transfer]




1FZ_F_7(4Q45)
DPO4_ECOLI
[Raw transfer]




DCP_A_6(1S10)
DPO4_SULSO
[Raw transfer]




1FZ_F_7(4Q45)
DPO4_ECOLI
[Raw transfer]




DCP_B_14(2XCP)
DPO4_SULSO
[Raw transfer]




TTP_A_10(2W9C)
DPO4_SULSO
[Raw transfer]




1FZ_A_8(4R8U)
DPO4_ECOLI
[Raw transfer]




1FZ_A_10(4Q45)
DPO4_ECOLI
[Raw transfer]




DGT_A_4(2V4Q)
DPO4_SULSO
[Raw transfer]




DGT_P_7(2J6U)
DPO4_SULSO
[Raw transfer]




ATP_A_6(1RYR)
DPO4_SULSO
[Raw transfer]




DTP_A_4(2BQR)
DPO4_SULSO
[Raw transfer]




TTP_B_14(2W9C)
DPO4_SULSO
[Raw transfer]




ATP_B_14(1RYS)
DPO4_SULSO
[Raw transfer]




TMP_A_11(2RDJ)
DPO4_SULSO
[Raw transfer]




0OJ_A_7(4GC7)
DPO4_SULSO
[Raw transfer]




TTP_T_9(4TQR)
DPO4_SULSO
[Raw transfer]




DCP_A_7(4TQS)
DPO4_SULSO
[Raw transfer]




ATP_A_13(1RYS)
DPO4_SULSO
[Raw transfer]




0OH_A_4(4GC6)
DPO4_SULSO
[Raw transfer]




NACID_H_7(1S97)
DPO4_SULSO
[Raw transfer]

-

NACID_H_7(1S9F)
DPO4_SULSO
[Raw transfer]

-

NACID_D_4(2W9B)
DPO4_SULSO
[Raw transfer]

-

GOL_A_22(3FDS)
DPO4_SULSO
[Raw transfer]




GOL_A_12(2RDJ)
DPO4_SULSO
[Raw transfer]




NACID_C_1(1N56)
DPO4_SULSO
[Raw transfer]

-

DOC_C_13(4TQS)
?
[Raw transfer]




DTP_A_5(2C2D)
DPO4_SULSO
[Raw transfer]




NACID_P_1(1JX4)
DPO4_SULSO
[Raw transfer]

-

NACID_C_3(2IA6)
DPO4_SULSO
[Raw transfer]

-

NACID_G_5(1S9F)
DPO4_SULSO
[Raw transfer]

-

NACID_E_5(2VA2)
DPO4_SULSO
[Raw transfer]

-

NACID_E_1(1S9F)
DPO4_SULSO
[Raw transfer]

-

NACID_P_2(2BQU)
DPO4_SULSO
[Raw transfer]

-

NACID_E_5(2IA6)
DPO4_SULSO
[Raw transfer]

-

NACID_P_2(2BQR)
DPO4_SULSO
[Raw transfer]

-

NACID_P_2(2V4R)
DPO4_SULSO
[Raw transfer]

-

NACID_P_5(2XCP)
DPO4_SULSO
[Raw transfer]

-

NACID_P_1(2R8I)
DPO4_SULSO
[Raw transfer]

-

NACID_C_3(2W9B)
DPO4_SULSO
[Raw transfer]

-

NACID_D_1(2IBK)
DPO4_SULSO
[Raw transfer]

-

NACID_E_3(1S0M)
DPO4_SULSO
[Raw transfer]

-

NACID_C_1(1S0O)
DPO4_SULSO
[Raw transfer]

-

NACID_P_1(2R8G)
DPO4_SULSO
[Raw transfer]

-

NACID_E_3(1S0O)
DPO4_SULSO
[Raw transfer]

-

NACID_P_2(2XC9)
DPO4_SULSO
[Raw transfer]

-

NACID_P_2(2BR0)
DPO4_SULSO
[Raw transfer]

-

NACID_P_2(3M9M)
DPO4_SULSO
[Raw transfer]

-

NACID_E_5(2V9W)
DPO4_SULSO
[Raw transfer]

-

NACID_P_2(2W9A)
DPO4_SULSO
[Raw transfer]

-

NACID_P_2(2J6T)
DPO4_SULSO
[Raw transfer]

-

NACID_P_1(1JXL)
DPO4_SULSO
[Raw transfer]

-

NACID_F_3(1S97)
DPO4_SULSO
[Raw transfer]

-

NACID_P_1(2R8H)
DPO4_SULSO
[Raw transfer]

-

NACID_P_2(2C22)
DPO4_SULSO
[Raw transfer]

-

NACID_P_2(2C28)
DPO4_SULSO
[Raw transfer]

-

NACID_C_1(1S0M)
DPO4_SULSO
[Raw transfer]

-

NACID_P_2(2JEG)
DPO4_SULSO
[Raw transfer]

-

NACID_E_5(4GC7)
?
[Raw transfer]

-

EDO_A_16(3FDS)
DPO4_SULSO
[Raw transfer]




NACID_F_6(4RZR)
?
[Raw transfer]

-

NACID_C_3(4RZR)
DPO4_SULSO
[Raw transfer]

-

6 PsiBlast_PDB 71.0235% -16 - C3 -4IR1 4.6 DPO4_ECOLI
3 PsiBlast_PDB 69.8235% -12 - C3 -4IRK 3.3 DPO4_ECOLI
23 PsiBlast_CBE 69.6235% -13 - C3 -4IRK 5.6 DPO4_ECOLI
26 PsiBlast_CBE 69.6035% -13 - C3 -4Q43 4.6 DPO4_ECOLI
5 PsiBlast_PDB 69.3235% -14 - C3 -4Q45 4.5 DPO4_ECOLI
9 PsiBlast_PDB 69.2735% -12 - C3 -4R8U 4.5 DPO4_ECOLI
113 HHSearch 69.2136% -18 - C3 -4Q45 4.5 DPO4_ECOLI
4 PsiBlast_PDB 69.1635% -12 - C3 -4Q44 4.5 DPO4_ECOLI
2 PsiBlast_PDB 69.0635% -12 - C3 -4IRD 4.9 DPO4_ECOLI
22 PsiBlast_CBE 68.9435% -17 - C3 -4Q44 5.4 DPO4_ECOLI
7 PsiBlast_PDB 68.8535% -13 - C3 -4IR9 4.2 DPO4_ECOLI
1 PsiBlast_PDB 68.6535% -7 - C3 -4IRC 3.9 DPO4_ECOLI
21 PsiBlast_CBE 68.6335% -12 - C3 -4Q45 3.5 DPO4_ECOLI
28 PsiBlast_CBE 68.3235% -13 - C3 -4IR1 4.0 DPO4_ECOLI
29 PsiBlast_CBE 68.0234% -12 - C3 -4R8U 5.5 ?
27 PsiBlast_CBE 68.0235% -9 - C3 -4IR9 5.5 DPO4_ECOLI
24 PsiBlast_CBE 68.0035% -9 - C3 -4IRD 6.1 DPO4_ECOLI
8 PsiBlast_PDB 67.9635% -12 - C3 -4Q43 4.7 DPO4_ECOLI
25 PsiBlast_CBE 67.5635% -9 - C3 -4IRC 4.4 DPO4_ECOLI
121 HHSearch 66.8228% -19 - C3 -4ECQ - POLH_HUMAN -
56 PsiBlast_CBE 56.9133% 5 - C3 -2V4R 4.6 DPO4_SULSO
10 PsiBlast_PDB 56.4934% -2 - C3 -2W9B 2.5 DPO4_SULSO
60 PsiBlast_CBE 56.3033% 9 - C3 -2R8I 2.9 DPO4_SULSO
59 PsiBlast_CBE 56.2433% 8 - C3 -2RDJ 3.5 DPO4_SULSO
11 PsiBlast_PDB 56.2134% 0 - C3 -2W9C 5.2 DPO4_SULSO
88 PsiBlast_CBE 55.9533% 7 - C3 -1S97 3.3 DPO4_SULSO
85 PsiBlast_CBE 55.9333% 7 - C3 -1S9F 3.8 DPO4_SULSO
43 PsiBlast_CBE 55.9033% 8 - C3 -2XCP 4.3 DPO4_SULSO
52 PsiBlast_CBE 55.8733% 1 - C3 -2VA2 Error DPO4_SULSO
86 PsiBlast_CBE 55.8433% 4 - C3 -1S97 3.3 DPO4_SULSO
92 PsiBlast_CBE 55.8033% 9 - C3 -1S0O 0.9 DPO4_SULSO
32 PsiBlast_CBE 55.8033% 3 - C3 -4TQS 4.5 DPO4_SULSO
36 PsiBlast_CBE 55.7433% 8 - C3 -4GC7 4.4 DPO4_SULSO
31 PsiBlast_CBE 55.7033% 6 - C3 -4TQS 2.9 ?
65 PsiBlast_CBE 55.6333% 7 - C3 -2JEG 3.1 DPO4_SULSO
37 PsiBlast_CBE 55.5533% 5 - C3 -4GC6 5.3 DPO4_SULSO
33 PsiBlast_CBE 55.4833% 3 - C3 -4RZR 0.0 ?
82 PsiBlast_CBE 55.4033% 3 - C3 -1S9F 2.5 DPO4_SULSO
90 PsiBlast_CBE 55.3833% 8 - C3 -1S10 4.6 DPO4_SULSO
57 PsiBlast_CBE 55.3433% 6 - C3 -2V4Q 5.2 DPO4_SULSO
75 PsiBlast_CBE 55.3033% 11 - C3 -2C2D 3.5 DPO4_SULSO
35 PsiBlast_CBE 55.2833% 8 - C3 -4GC7 3.2 ?
91 PsiBlast_CBE 55.2733% 7 - C3 -1S0O 3.8 DPO4_SULSO
34 PsiBlast_CBE 55.2633% 2 - C3 -4RZR 2.0 DPO4_SULSO
80 PsiBlast_CBE 55.2133% 7 - C3 -2BQR 4.5 DPO4_SULSO
68 PsiBlast_CBE 55.1333% 6 - C3 -2J6T 1.8 DPO4_SULSO
20 PsiBlast_PDB 55.1233% 9 - C3 -1S0M 2.1 DPO4_SULSO
78 PsiBlast_CBE 55.0833% 8 - C3 -2BR0 0.6 DPO4_SULSO
67 PsiBlast_CBE 55.0633% 4 - C3 -2J6U 6.3 DPO4_SULSO
15 PsiBlast_PDB 55.0433% 9 - C3 -1JXL 4.7 DPO4_SULSO
77 PsiBlast_CBE 55.0033% 10 - C3 -2C22 4.3 DPO4_SULSO
45 PsiBlast_CBE 54.9833% 9 - C3 -2XC9 Error DPO4_SULSO
19 PsiBlast_PDB 54.9333% 11 - C3 -1RYS 6.0 DPO4_SULSO
94 PsiBlast_CBE 54.8933% 6 - C3 -1S0M 4.1 DPO4_SULSO
62 PsiBlast_CBE 54.8733% 11 - C3 -2R8G 2.5 DPO4_SULSO
79 PsiBlast_CBE 54.7233% 9 - C3 -2BQU 1.2 DPO4_SULSO
42 PsiBlast_CBE 54.6933% 5 - C3 -2XCP 5.1 DPO4_SULSO
41 PsiBlast_CBE 54.5533% -0 - C3 -3FDS 2.9 DPO4_SULSO
40 PsiBlast_CBE 54.5033% 12 - C3 -3M9M 2.1 DPO4_SULSO
70 PsiBlast_CBE 54.4833% 8 - C3 -2IBK 4.1 DPO4_SULSO
83 PsiBlast_CBE 54.4433% 6 - C3 -1S9F 3.0 DPO4_SULSO
71 PsiBlast_CBE 54.4033% 10 - C3 -2IA6 3.5 DPO4_SULSO
18 PsiBlast_PDB 54.1733% 13 - C3 -1RYR 4.6 DPO4_SULSO
76 PsiBlast_CBE 54.1133% 11 - C3 -2C28 1.0 DPO4_SULSO
72 PsiBlast_CBE 54.0433% 11 - C3 -2IA6 3.3 DPO4_SULSO
95 PsiBlast_CBE 54.0033% 11 * C3 *1RYS 5.2 DPO4_SULSO
93 PsiBlast_CBE 53.9433% 10 - C3 -1S0N 5.1 DPO4_SULSO
48 PsiBlast_CBE 53.9433% 12 - C3 -2W9A 1.4 DPO4_SULSO
96 PsiBlast_CBE 53.9233% 6 - C3 -1N56 4.6 DPO4_SULSO
17 PsiBlast_PDB 53.8533% 8 - C3 -1N56 3.7 DPO4_SULSO
61 PsiBlast_CBE 53.7633% 12 - C3 -2R8H 2.0 DPO4_SULSO
46 PsiBlast_CBE 53.7333% 4 - C3 -2W9C 4.2 DPO4_SULSO
54 PsiBlast_CBE 53.1133% 9 - C3 -2V9W 3.4 DPO4_SULSO
103 Fugue 51.2137% -6 - C3 -1JX4 5.0 DPO4_SULSO
47 PsiBlast_CBE 50.8633% 9 - C3 -2W9B 1.7 DPO4_SULSO