@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu24020: (2016-07-07 )
MKESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIAE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_B_2(3Q2Y)
BMRR_BACSU
[Raw transfer]

-

CHAIN_B_2(3D70)
BMRR_BACSU
[Raw transfer]

-

CHAIN_B_2(3Q5R)
BMRR_BACSU
[Raw transfer]

-

CHAIN_B_2(3Q5P)
BMRR_BACSU
[Raw transfer]

-

CHAIN_B_2(3Q5S)
BMRR_BACSU
[Raw transfer]

-

CHAIN_B_2(3Q1M)
BMRR_BACSU
[Raw transfer]

-

CHAIN_M_1(3D71)
BMRR_BACSU
[Raw transfer]

-

CHAIN_B_2(3Q3D)
BMRR_BACSU
[Raw transfer]

-

NACID_M_1(1EXJ)
BMRR_BACSU
[Raw transfer]

-

CHAIN_B_1(3D6Z)
BMRR_BACSU
[Raw transfer]

-

NACID_M_1(1EXJ)
BMRR_BACSU
[Raw transfer]

-

CHAIN_B_1(3D6Y)
BMRR_BACSU
[Raw transfer]

-

NACID_M_1(1EXJ)
BMRR_BACSU
[Raw transfer]

-

NACID_M_1(1EXI)
BMRR_BACSU
[Raw transfer]

-

3 PsiBlast_PDB 100.00100% 0 - C- -1R8E - BMRR_BACSU -
13 PsiBlast_PDB 95.5199%-138 - C2 -3D6Y 5.7 BMRR_BACSU
6 PsiBlast_PDB 95.0599%-138 - C2 -3D71 5.4 BMRR_BACSU
5 PsiBlast_PDB 94.7599%-144 - C2 -3Q5P 5.7 BMRR_BACSU
8 PsiBlast_PDB 94.3899%-133 - C2 -3Q2Y 5.1 BMRR_BACSU
7 PsiBlast_PDB 94.1799%-132 - C2 -3Q1M 5.7 BMRR_BACSU
12 PsiBlast_PDB 94.1099%-144 - C2 -3D70 5.3 BMRR_BACSU
14 PsiBlast_PDB 93.7199%-137 - C2 -3D6Z 5.5 BMRR_BACSU
9 PsiBlast_PDB 93.6799%-138 - C2 -3Q3D 4.7 BMRR_BACSU
24 Fugue 92.55100%-145 - C2 -1EXJ 4.1 BMRR_BACSU
2 PsiBlast_PDB 92.45100%-145 - C2 -1EXJ 4.1 BMRR_BACSU
10 PsiBlast_PDB 92.0599%-139 - C2 -3Q5S 6.4 BMRR_BACSU
11 PsiBlast_PDB 91.2899%-130 - C2 -3Q5R 5.2 BMRR_BACSU
1 PsiBlast_PDB 91.07100%-138 - C2 -1EXI 3.8 BMRR_BACSU
4 PsiBlast_PDB 90.5099%-132 - C2 -3IAO - BMRR_BACSU -
33 HHSearch 89.8191% 0 - C- -1R8E - BMRR_BACSU -
23 Fugue 65.2898%-157 - C2 -1BOW - BMRR_BACSU -
15 PsiBlast_PDB 64.8299%-157 - C2 -1BOW - BMRR_BACSU -
25 Fugue 58.45100%-150 - C2 -1EXJ 4.1 BMRR_BACSU
16 PsiBlast_PDB 54.1399%-151 - C2 -2BOW - BMRR_BACSU -