@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu24080: (2016-07-08 )
MELFKYMEKYDYEQLVFCQDEQSGLKAIIAIHDTTLGPALGGTRMWTYENEEAAIEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEEMFRAFGRYIQGLNGRYITAEDVGTTVEDMDIIHDETDYVTGISPAFGSSGNPSPVTAYGVYRGMKAAAKAAFGTDSLEGKTIAVQGVGNVAYNLCRHLHEEGANLIVTDINKQSVQRAVEDFGARAVDPDDIYSQDCDIYAPCALGATINDDTIKQLKAKVIAGAANNQLKETRHGDQIHEMGIVYAPDYVINAGGVINVADELYGYNAERALKKVEGIYGNIERVLEISQRDGIPAYLAADRLAEERIERMRRSRSQFLQNGHSVLSRR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_A_12(1C1D)
DHPH_RHOSO
[Raw transfer]




NAD_A_12(1C1D)
DHPH_RHOSO
[Raw transfer]




NAD_B_13(1C1D)
DHPH_RHOSO
[Raw transfer]




NAD_A_10(1C1X)
DHPH_RHOSO
[Raw transfer]




PPY_B_11(1BW9)
DHPH_RHOSO
[Raw transfer]




HCI_A_6(1BXG)
DHPH_RHOSO
[Raw transfer]




NAD_B_11(1C1X)
DHPH_RHOSO
[Raw transfer]




HCI_B_8(1BXG)
DHPH_RHOSO
[Raw transfer]




NAD_B_7(1BXG)
DHPH_RHOSO
[Raw transfer]




NAD_A_5(1BXG)
DHPH_RHOSO
[Raw transfer]




NAD_A_8(1BW9)
DHPH_RHOSO
[Raw transfer]




EDO_B_14(1BW9)
DHPH_RHOSO
[Raw transfer]




2 PsiBlast_PDB 91.8576% -99 - C7 -1LEH - ? -
124 HHSearch 91.6076% -99 - C7 -1LEH - ? -
1 PsiBlast_PDB 90.9579%-104 - C7 -3VPX - ? -
116 Fugue 69.0671% 6 - C7 -1LEH - ? -
128 HHSearch 62.3437% 10 - C7 -1C1D 9.8 DHPH_RHOSO
5 PsiBlast_PDB 61.9238% 7 - C7 -1C1D 9.9 DHPH_RHOSO
24 PsiBlast_CBE 61.5038% 6 - C7 -1C1D 8.9 DHPH_RHOSO
3 PsiBlast_PDB 61.3738% 8 - C7 -1BW9 7.6 DHPH_RHOSO
4 PsiBlast_PDB 61.0338% 9 - C7 -1C1X 8.7 DHPH_RHOSO
22 PsiBlast_CBE 60.7038% 10 - C7 -1C1X 8.7 DHPH_RHOSO
6 PsiBlast_PDB 60.2938% 11 - C7 -1BXG 7.4 DHPH_RHOSO
21 PsiBlast_CBE 60.2738% 11 - C7 -1BW9 4.4 DHPH_RHOSO
23 PsiBlast_CBE 59.7738% 9 - C7 -1BXG 7.4 DHPH_RHOSO
126 HHSearch 51.3532% 23 - C7 -3AOG - ? -
9 PsiBlast_PDB 51.0829% 24 - C7 -3AOE - ? -
139 HHSearch 51.0034% 20 - C7 -1V9L - ? -
10 PsiBlast_PDB 50.9929% 25 - C7 -3AOG - ? -
127 HHSearch 50.5327% 11 - C7 -3K92 - DHE2_BACSU -
131 HHSearch 49.8624% 8 - C7 -3AOE - ? -
125 HHSearch 48.9628% 30 - C7 -4XGI - ? -