@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu24160: (2016-07-08 )
MEIKQIMVAGAGQMGSGIAQTAADAGFYVRMYDVNPEAAEAGLKRLKKQLARDAEKGKRTETEVKSVINRISISQTLEEAEHADIVIEAIAENMAAKTEMFKTLDRICPPHTILASNTSSLPITEIAAVTNRPQRVIGMHFMNPVPVMKLVEVIRGLATSEETALDVMALAEKMGKTAVEVNDFPGFVSNRVLLPMINEAIYCVYEGVAKPEAIDEVMKLGMNHPMGPLALADFIGLDTCLSIMEVLHSGLGDSKYRPCPLLRKYVKAGWLGKKSGRGFYDYEEKTS

Atome Classification :

(39 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_C_7(4KUG)
?
[Raw transfer]




NAD_A_5(4KUG)
?
[Raw transfer]




NAD_A_3(3HAD)
HCDH_HUMAN
[Raw transfer]




NAI_A_3(1F17)
HCDH_HUMAN
[Raw transfer]




NAD_B_4(3HAD)
HCDH_HUMAN
[Raw transfer]




NAD_D_8(4KUG)
?
[Raw transfer]




NAI_B_4(1F17)
HCDH_HUMAN
[Raw transfer]




NAD_C_3(1LSO)
HCDH_HUMAN
[Raw transfer]




NAD_B_6(4KUG)
?
[Raw transfer]




NAD_F_6(3HDH)
HCDH_PIG
[Raw transfer]




NAD_D_4(1LSO)
HCDH_HUMAN
[Raw transfer]




NAD_E_5(3HDH)
HCDH_PIG
[Raw transfer]




NAD_D_4(1LSJ)
HCDH_HUMAN
[Raw transfer]




NAD_A_2(4E13)
?
[Raw transfer]




NAD_C_3(1LSJ)
HCDH_HUMAN
[Raw transfer]




CAA_C_3(1IL0)
HCDH_HUMAN
[Raw transfer]




CAA_D_4(1IL0)
HCDH_HUMAN
[Raw transfer]




CAA_C_3(1F0Y)
HCDH_HUMAN
[Raw transfer]




CAA_D_4(1M75)
HCDH_HUMAN
[Raw transfer]




CAA_D_4(1M76)
HCDH_HUMAN
[Raw transfer]




CAA_C_3(1M76)
HCDH_HUMAN
[Raw transfer]




CAA_C_3(1M75)
HCDH_HUMAN
[Raw transfer]




CAA_D_4(1F0Y)
HCDH_HUMAN
[Raw transfer]




100 HHSearch 97.4556%-125 - C2 -4R1N - ? -
2 PsiBlast_PDB 97.0155%-125 - C2 -4R1N - ? -
3 PsiBlast_PDB 96.7555%-124 - C2 -4KUG 9.2 ?
25 PsiBlast_CBE 96.4456%-122 - C2 -4KUH - ? -
30 PsiBlast_CBE 95.9956%-121 - C2 -4KUH - ? -
28 PsiBlast_CBE 95.8356%-121 - C2 -4KUH - ? -
4 PsiBlast_PDB 95.6656%-121 - C2 -4KUH - ? -
29 PsiBlast_CBE 95.4756%-118 - C2 -4KUH - ? -
27 PsiBlast_CBE 95.2456%-120 - C2 -4KUH - ? -
23 PsiBlast_CBE 95.1655%-123 - C2 -4KUG 8.3 ?
22 PsiBlast_CBE 95.0255%-122 - C2 -4KUG 8.5 ?
24 PsiBlast_CBE 94.6756%-115 - C2 -4KUH - ? -
1 PsiBlast_PDB 94.6555%-122 - C2 -4KUE - ? -
26 PsiBlast_CBE 94.6056%-117 - C2 -4KUH - ? -
21 PsiBlast_CBE 93.8555%-120 - C2 -4KUG 8.8 ?
44 PsiBlast_CBE 92.6351%-127 - C2 -4PZD - ? -
40 PsiBlast_CBE 92.1651%-136 - C2 -4PZD - ? -
99 HHSearch 91.9551%-126 - C2 -4PZC - ? -
5 PsiBlast_PDB 91.9551%-126 - C2 -4PZC - ? -
41 PsiBlast_CBE 91.8251%-124 - C2 -4PZD - ? -
8 PsiBlast_PDB 67.7941% -11 - C2 -1F0Y 5.0 HCDH_HUMAN
16 PsiBlast_PDB 67.7341% -12 - C2 -3HAD 8.7 HCDH_HUMAN
17 PsiBlast_PDB 67.6541% -15 - C2 -1M76 4.7 HCDH_HUMAN
11 PsiBlast_PDB 67.2841% -16 - C2 -1F17 8.5 HCDH_HUMAN
55 PsiBlast_CBE 67.2141% -12 - C2 -1M76 5.4 HCDH_HUMAN
48 PsiBlast_CBE 67.1641% -14 - C2 -1F17 8.6 HCDH_HUMAN
15 PsiBlast_PDB 66.8641% -18 - C2 -1LSO 9.2 HCDH_HUMAN
13 PsiBlast_PDB 66.7641% -9 - C2 -1IL0 5.7 HCDH_HUMAN
51 PsiBlast_CBE 66.4741% -13 - C2 -1LSJ 7.3 HCDH_HUMAN
52 PsiBlast_CBE 66.3441% -8 - C2 -1IL0 4.3 HCDH_HUMAN
56 PsiBlast_CBE 66.2141% -8 - C2 -1M75 5.1 HCDH_HUMAN
54 PsiBlast_CBE 65.9341% -12 - C2 -3HAD 8.9 HCDH_HUMAN
18 PsiBlast_PDB 65.8141% -11 - C2 -1M75 5.1 HCDH_HUMAN
47 PsiBlast_CBE 65.6541% -8 - C2 -1F0Y 5.8 HCDH_HUMAN
14 PsiBlast_PDB 65.2941% -15 - C2 -1LSJ 6.2 HCDH_HUMAN
12 PsiBlast_PDB 64.5240% -6 - C2 -3HDH 9.1 HCDH_PIG
50 PsiBlast_CBE 64.3640% -8 - C2 -3HDH 8.7 HCDH_PIG
53 PsiBlast_CBE 64.0541% -19 - C2 -1LSO 8.7 HCDH_HUMAN
86 PsiBlast_CBE 62.1731% -20 - C2 -4E13 8.4 ?