@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu24180: (2016-07-08 )
MTKIFAHRGASGQFPENTMLAFEKGIEAGADGIELDVQLTKDGRIVVIHDERLNRTTSLKGFVKDTAYDEVKTANAAAGHDQAYSDIKVPLLEDVLSWAVKKDFLINIELKNSVIRYEGMEEKVLEAVKRFNVEDRVILSTFNHDSLALCARLAPHIERAVLTSDVLYQADRYIASIPASGYHPKINSPGVTDEVLKKMRNGLIKVRPYTVNRPEDMKRLIEAGADGMFTDFPEKASALLKNE

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

G3P_A_5(3QVQ)
?
[Raw transfer]




CIT_A_2(3CH0)
?
[Raw transfer]




GOL_A_2(1VD6)
?
[Raw transfer]




GOL_A_4(2PZ0)
?
[Raw transfer]




GOL_A_4(2PZ0)
?
[Raw transfer]




GOL_B_6(2PZ0)
?
[Raw transfer]




21 PsiBlast_CBE 92.8042% -96 - C5 -2PZ0 2.6 ?
1 PsiBlast_PDB 92.6842% -93 - C5 -2PZ0 2.3 ?
52 HHSearch 87.2243% -28 - C5 -2PZ0 2.3 ?
50 HHSearch 75.1828% -31 * C5 *3QVQ - ? -
6 PsiBlast_PDB 72.8428% -26 - C5 -3QVQ 3.7 ?
24 PsiBlast_CBE 72.6531% -1 - C5 -4R7O - ? -
25 PsiBlast_CBE 72.3831% 5 - C5 -4R7O - ? -
2 PsiBlast_PDB 72.3731% 5 - C5 -4R7O - ? -
53 HHSearch 72.2526% -46 - C5 -1ZCC - ? -
55 HHSearch 72.1333% 1 - C5 -4R7O - ? -
22 PsiBlast_CBE 71.7231% 7 - C5 -4R7O - ? -
27 PsiBlast_CBE 71.0831% 6 - C5 -4R7O - ? -
26 PsiBlast_CBE 70.8931% 5 - C5 -4R7O - ? -
23 PsiBlast_CBE 70.6731% 10 - C5 -4R7O - ? -
70 Fugue 70.1825% -71 - C5 -1ZCC - ? -
59 HHSearch 69.2828% 1 - C5 -3L12 - ? -
51 HHSearch 67.9123% -37 - C5 -3KS6 - ? -
7 PsiBlast_PDB 67.7126% -36 - C5 -2OTD - ? -
54 HHSearch 67.2732% -21 - C5 -4OEC - ? -
58 HHSearch 66.5836% 49 - C5 -2OOG - ? -
62 HHSearch 62.2131% -4 - C5 -1VD6 2.5 ?