@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu24250: (2016-07-08 )
MNKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSYKYSLPADQRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL

Atome Classification :

(26 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ARG_B_4(2P5M)
ARGR_BACSU
[Raw transfer]




ARG_B_4(2P5M)
ARGR_BACSU
[Raw transfer]




ARG_B_4(2P5M)
ARGR_BACSU
[Raw transfer]




ARG_B_4(2P5M)
ARGR_BACSU
[Raw transfer]




ARG_F_11(1B4B)

[Raw transfer]




ARG_E_9(1B4B)
ARGR_GEOSE
[Raw transfer]




ARG_F_11(1B4B)
ARGR_GEOSE
[Raw transfer]




ARG_F_11(1B4B)
ARGR_GEOSE
[Raw transfer]




ARG_F_11(1B4B)
ARGR_GEOSE
[Raw transfer]




ARG_D_14(1XXA)
ARGR_ECOLI
[Raw transfer]




ARG_F_12(2ZFZ)
ARGR_MYCTU
[Raw transfer]




1 PsiBlast_PDB 91.57100%-152 - C8 -1F9N - ARGR_BACSU -
64 HHSearch 84.2572%-159 - C7 -1B4A - ARGR_GEOSE -
2 PsiBlast_PDB 84.0471%-159 - C7 -1B4A - ARGR_GEOSE -
22 PsiBlast_CBE 72.55100%-182 - C8 -2P5M 4.3 ARGR_BACSU
66 HHSearch 71.88100%-200 - C8 -2P5M 3.8 ARGR_BACSU
21 PsiBlast_CBE 71.13100%-208 - C8 -2P5M 3.8 ARGR_BACSU
3 PsiBlast_PDB 71.11100%-184 - C8 -2P5M 3.9 ARGR_BACSU
33 PsiBlast_CBE 65.5434%-105 - C8 -3LAJ - ARGR_MYCTU -
30 PsiBlast_CBE 65.4934%-102 - C8 -3LAP - ARGR_MYCTU -
35 PsiBlast_CBE 64.8934%-105 - C8 -3LAJ - ARGR_MYCTU -
34 PsiBlast_CBE 64.7634%-103 - C8 -3LAJ - ARGR_MYCTU -
28 PsiBlast_CBE 64.5734%-101 - C8 -3LAP - ARGR_MYCTU -
42 PsiBlast_CBE 64.3934% -88 - C8 -3FHZ - ARGR_MYCTU -
41 PsiBlast_CBE 64.3934% -87 - C8 -3FHZ - ARGR_MYCTU -
29 PsiBlast_CBE 64.2034%-105 - C8 -3LAP - ARGR_MYCTU -
8 PsiBlast_PDB 64.0834%-109 - C8 -3FHZ - ARGR_MYCTU -
40 PsiBlast_CBE 63.9834% -87 - C8 -3FHZ - ARGR_MYCTU -
38 PsiBlast_CBE 63.7334%-108 - C8 -3FHZ - ARGR_MYCTU -
39 PsiBlast_CBE 63.5534%-108 - C8 -3FHZ - ARGR_MYCTU -
26 PsiBlast_CBE 63.0563%-231 - C8 -1B4B 2.5
84 Fugue 61.4963%-226 * C8 *1B4B 2.8 ARGR_GEOSE
6 PsiBlast_PDB 61.4963%-226 - C8 -1B4B 2.8 ARGR_GEOSE
27 PsiBlast_CBE 61.3863%-219 - C8 -1B4B 2.7 ARGR_GEOSE
68 HHSearch 61.2963%-226 - C8 -1B4B 2.8 ARGR_GEOSE
69 HHSearch 54.0034%-161 - C8 -1XXA 2.8 ARGR_ECOLI
67 HHSearch 51.9530%-165 - C8 -2ZFZ 3.0 ARGR_MYCTU