@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu24520: (2016-07-08 )
MTTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTEHHNQ

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EPE_A_4(3R60)
MNTR_BACSU
[Raw transfer]




EPE_B_6(3R60)
MNTR_BACSU
[Raw transfer]




EPE_B_6(3R61)
MNTR_BACSU
[Raw transfer]




EPE_B_8(4HV5)
MNTR_BACSU
[Raw transfer]




GOL_A_7(2EV6)
MNTR_BACSU
[Raw transfer]




FLC_B_5(2EV6)
MNTR_BACSU
[Raw transfer]




43 PsiBlast_PDB 92.6999%-173 - C1 -1ON2 - MNTR_BACSU -
1 HHSearch 92.6999%-173 - C1 -1ON2 - MNTR_BACSU -
60 PsiBlast_CBE 91.46100%-186 - C1 -3R60 Error MNTR_BACSU
53 PsiBlast_CBE 90.62100%-181 - C1 -2F5D - MNTR_BACSU -
35 PsiBlast_PDB 90.28100%-171 - C1 -2F5C - MNTR_BACSU -
51 PsiBlast_CBE 88.61100%-173 - C1 -2F5F - MNTR_BACSU -
54 PsiBlast_CBE 88.55100%-180 - C1 -2EV6 3.0 MNTR_BACSU
46 PsiBlast_PDB 88.4099%-184 - C- -4HX8 - MNTR_BACSU -
55 PsiBlast_CBE 88.06100%-175 - C1 -2EV5 - MNTR_BACSU -
47 PsiBlast_PDB 87.8399%-162 - C1 -4HV6 - MNTR_BACSU -
52 PsiBlast_CBE 87.68100%-178 - C1 -2F5E - MNTR_BACSU -
61 PsiBlast_CBE 87.6799%-167 - C1 -1ON2 - MNTR_BACSU -
33 PsiBlast_PDB 87.55100%-175 - C1 -2EV5 - MNTR_BACSU -
32 PsiBlast_PDB 87.26100%-178 - C1 -2EV0 - MNTR_BACSU -
59 PsiBlast_CBE 87.10100%-187 - C1 -3R61 3.2 MNTR_BACSU
63 PsiBlast_CBE 86.9399%-188 - C1 -4HX4 - MNTR_BACSU -
36 PsiBlast_PDB 86.83100%-183 - C1 -2F5D - MNTR_BACSU -
56 PsiBlast_CBE 86.73100%-169 - C1 -2EV0 - MNTR_BACSU -
34 PsiBlast_PDB 86.48100%-175 * C1 *2EV6 2.9 MNTR_BACSU
57 PsiBlast_CBE 86.28100%-176 - C1 -1ON1 - MNTR_BACSU -
40 PsiBlast_PDB 85.41100%-171 - C1 -3R60 Error MNTR_BACSU
58 PsiBlast_CBE 85.26100%-180 - C1 -4HV5 2.3 MNTR_BACSU