@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu25160: (2016-07-09 )
MDVIKISPRGYCYGVVDAMVIAKNASLDKSLPRPIYILGMIVHNKHVTDAFEEEGIFTLDGSNRLDILKQVDKGTVIFTAHGVSPEVRRIAEEKGLVAIDATCPDVTKTHNLILEMKEKGYHVIYIGKKGHPEPEGAVGVAPEIVHLVETEEDVKNLDIQSEKLIVTNQTTMSQWDVHDIMELVKEKYPHVEYHQEICLATQVRQEAVSEQAKKADLTIVVGDPKSNNSNRLAQVSEEIAGTKAYRIGDLSELKLEWLKGVNTVAVTAGASTPTPITKEVIRFLEQFDHEDPSTWTTEHNIPLKKILPKVKAKN

Atome Classification :

(63 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2E5_B_6(4MUY)
?
[Raw transfer]




2E4_B_6(4MUX)
?
[Raw transfer]




0O3_B_6(4EB3)
ISPH_ECOLI
[Raw transfer]




0JX_B_6(3UTC)
ISPH_ECOLI
[Raw transfer]




EIP_A_4(3KE8)
ISPH_ECOLI
[Raw transfer]




H6P_A_4(3SZO)
ISPH_ECOLI
[Raw transfer]




2E6_B_6(4MV0)
?
[Raw transfer]




10E_B_6(4H4D)
ISPH_ECOLI
[Raw transfer]




0CN_B_6(3UV7)
ISPH_ECOLI
[Raw transfer]




10E_B_6(3ZGL)
ISPH_ECOLI
[Raw transfer]




0CM_B_6(3UV3)
ISPH_ECOLI
[Raw transfer]




2E7_A_4(4MV5)
?
[Raw transfer]




0CM_A_4(3UV3)
ISPH_ECOLI
[Raw transfer]




IPE_A_4(3KE9)
ISPH_ECOLI
[Raw transfer]




0CG_B_6(3URK)
ISPH_ECOLI
[Raw transfer]




0CG_A_4(3URK)
ISPH_ECOLI
[Raw transfer]




2E7_B_6(4MV5)
?
[Raw transfer]




10D_B_6(4H4C)
ISPH_ECOLI
[Raw transfer]




SF4_B_6(3UWM)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3UTC)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4EB3)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3UV3)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UV7)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UV3)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3ZGL)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4EB3)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3SZL)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3ZGL)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4MUX)
?
[Raw transfer]




SF4_A_3(3UV6)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4H4C)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3URK)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3KE9)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UWM)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UTC)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3KE8)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3SZO)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3URK)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4H4D)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3ZGN)
ISPH_ECOLI
[Raw transfer]




SF4_A_4(3ZGN)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3UV6)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3KE9)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4H4E)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3SZL)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4H4D)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4H4E)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4H4C)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3SZO)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3UV7)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4H4D)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3KE8)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4MUX)
?
[Raw transfer]




F3S_A_3(3SZU)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3T0F)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3F7T)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3KEL)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(4MUY)
?
[Raw transfer]




F3S_B_5(4MUY)
?
[Raw transfer]




F3S_B_5(3T0G)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(4MV0)
?
[Raw transfer]




F3S_B_5(3UTD)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3UTD)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3SZU)
ISPH_ECOLI
[Raw transfer]




F3S_B_9(3F7T)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(4MV0)
?
[Raw transfer]




F3S_A_3(3T0G)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3KEL)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3DNF)
ISPH_AQUAE
[Raw transfer]




F3S_A_3(3KEF)
ISPH_ECOLI
[Raw transfer]




F3S_B_4(3DNF)
ISPH_AQUAE
[Raw transfer]




F3S_A_2(4N7B)
?
[Raw transfer]




F3S_A_3(3DNF)
ISPH_AQUAE
[Raw transfer]




F3S_A_3(3T0F)
ISPH_ECOLI
[Raw transfer]




F3S_B_6(3KEM)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3KEF)
ISPH_ECOLI
[Raw transfer]




F3S_A_4(3KEM)
ISPH_ECOLI
[Raw transfer]




F3S_A_2(4N7B)
?
[Raw transfer]




F3S_A_3(3DNF)
ISPH_AQUAE
[Raw transfer]




77 PsiBlast_CBE 85.3536% -38 - C9 -4N7B 3.7 ?
73 PsiBlast_CBE 84.1237% -38 - C9 -3T0F 3.6 ISPH_ECOLI
51 PsiBlast_CBE 83.4438% -13 - C9 -3UWM 3.5 ISPH_ECOLI
56 PsiBlast_CBE 83.3538% -14 - C9 -3UTC 5.0 ISPH_ECOLI
25 PsiBlast_PDB 83.0238% -15 - C9 -4MV5 6.3 ?
3 HHSearch 83.0135% -14 - C9 -4N7B 3.7 ?
43 PsiBlast_CBE 82.7738% -15 - C9 -4MUY 5.7 ?
61 PsiBlast_CBE 82.6838% -14 - C9 -3KEL 3.4 ISPH_ECOLI
24 PsiBlast_PDB 82.6738% -12 - C9 -4MUX 3.6 ?
45 PsiBlast_CBE 82.6338% -15 - C9 -4EB3 4.9 ISPH_ECOLI
40 PsiBlast_PDB 82.6338% -15 - C9 -3KEF 3.4 ISPH_ECOLI
32 PsiBlast_PDB 82.6238% -14 - C9 -3UTC 3.6 ISPH_ECOLI
67 PsiBlast_CBE 82.6138% -15 - C9 -4H4D 6.1 ISPH_ECOLI
64 PsiBlast_CBE 82.5838% -14 - C9 -3KE8 3.6 ISPH_ECOLI
54 PsiBlast_CBE 82.4838% -14 - C9 -3UV3 5.7 ISPH_ECOLI
48 PsiBlast_CBE 82.4838% -13 - C9 -3SZO 3.6 ISPH_ECOLI
39 PsiBlast_PDB 82.4538% -14 - C9 -3KE9 5.4 ISPH_ECOLI
49 PsiBlast_CBE 82.4138% -14 - C9 -3SZL 3.6 ISPH_ECOLI
76 PsiBlast_CBE 82.3737% -16 - C9 -3T0G 3.6 ISPH_ECOLI
50 PsiBlast_CBE 82.3238% -15 - C9 -3F7T 3.1 ISPH_ECOLI
23 PsiBlast_PDB 82.2738% -13 - C9 -4MV0 3.6 ?
53 PsiBlast_CBE 82.2438% -17 - C9 -3UV6 3.6 ISPH_ECOLI
69 PsiBlast_CBE 82.2138% -14 * C9 *4H4C 5.0 ISPH_ECOLI
52 PsiBlast_CBE 82.2138% -16 - C9 -3UV7 5.3 ISPH_ECOLI
38 PsiBlast_PDB 82.1938% -10 - C9 -3KE8 5.5 ISPH_ECOLI
59 PsiBlast_CBE 82.1738% -14 - C9 -3KEM 3.3 ISPH_ECOLI
47 PsiBlast_CBE 82.1738% -12 - C9 -3ZGL 5.5 ISPH_ECOLI
44 PsiBlast_CBE 82.1738% -14 - C9 -4MUX 5.5 ?
58 PsiBlast_CBE 82.0938% -14 - C9 -3KEM 3.3 ISPH_ECOLI
60 PsiBlast_CBE 82.0438% -12 - C9 -3KEL 3.4 ISPH_ECOLI
30 PsiBlast_PDB 82.0438% -13 - C9 -3SZO 5.7 ISPH_ECOLI
41 PsiBlast_CBE 81.9238% -13 - C9 -4MV5 6.2 ?
27 PsiBlast_PDB 81.8738% -12 - C9 -3ZGN 3.5 ISPH_ECOLI
72 PsiBlast_CBE 81.8237% -17 - C9 -3SZU 3.6 ISPH_ECOLI
21 PsiBlast_PDB 81.8138% -11 - C9 -4EB3 3.6 ISPH_ECOLI
28 PsiBlast_PDB 81.7838% -14 - C9 -3F7T 3.2 ISPH_ECOLI
35 PsiBlast_PDB 81.7538% -13 - C9 -3UV6 3.7 ISPH_ECOLI
63 PsiBlast_CBE 81.7338% -10 - C9 -3KE9 3.6 ISPH_ECOLI
46 PsiBlast_CBE 81.7138% -12 - C9 -3ZGN 3.4 ISPH_ECOLI
22 PsiBlast_PDB 81.6238% -12 - C9 -4MUY 3.6 ?
57 PsiBlast_CBE 81.5338% -15 - C9 -3URK 5.1 ISPH_ECOLI
62 PsiBlast_CBE 81.5038% -15 - C9 -3KEF 3.4 ISPH_ECOLI
71 PsiBlast_CBE 81.4937% -16 - C9 -3SZU 3.6 ISPH_ECOLI
42 PsiBlast_CBE 81.4138% -14 - C9 -4MV0 5.8 ?
55 PsiBlast_CBE 81.3938% -15 - C9 -3UTD 3.6 ISPH_ECOLI
34 PsiBlast_PDB 81.3738% -12 - C9 -3UV3 5.6 ISPH_ECOLI
29 PsiBlast_PDB 81.2838% -12 - C9 -3SZL 3.6 ISPH_ECOLI
74 PsiBlast_CBE 81.2137% -18 - C9 -3T0F 3.6 ISPH_ECOLI
70 PsiBlast_CBE 81.2138% -16 - C9 -4H4C 3.5 ISPH_ECOLI
26 PsiBlast_PDB 81.1138% -10 - C9 -3ZGL 3.6 ISPH_ECOLI
75 PsiBlast_CBE 81.1037% -16 - C9 -3T0G 3.5 ISPH_ECOLI
68 PsiBlast_CBE 81.0938% -13 - C9 -4H4D 3.6 ISPH_ECOLI
36 PsiBlast_PDB 81.0938% -12 - C9 -3UV7 3.6 ISPH_ECOLI
31 PsiBlast_PDB 81.0538% -15 - C9 -3URK 5.3 ISPH_ECOLI
33 PsiBlast_PDB 81.0038% -12 - C9 -3UTD 3.6 ISPH_ECOLI
65 PsiBlast_CBE 80.8438% -14 - C9 -4H4E 3.6 ISPH_ECOLI
37 PsiBlast_PDB 80.7138% -11 - C9 -3UWM 3.6 ISPH_ECOLI
66 PsiBlast_CBE 80.5838% -12 - C9 -4H4E 3.6 ISPH_ECOLI
1 HHSearch 80.3339% 5 - C9 -4H4D 3.6 ISPH_ECOLI
2 HHSearch 78.8232% -47 - C9 -3DNF 3.5 ISPH_AQUAE
78 PsiBlast_CBE 76.5133% -57 - C9 -3DNF 3.6 ISPH_AQUAE
79 PsiBlast_CBE 75.0233% -52 - C9 -3DNF 3.5 ISPH_AQUAE
81 Fugue 69.0933% 47 - C9 -3DNF 3.5 ISPH_AQUAE