@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu25300: (2016-07-10 )
MNRQELITEALKARDMAYAPYSKFQVGAALLTKDGKVYRGCNIENAAYSMCNCAERTALFKAVSEGDTEFQMLAVAADTPGPVSPCGACRQVISELCTKDVIVVLTNLQGQIKEMTVEELLPGAFSSEDLHDERKL

Atome Classification :

(39 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

THU_B_8(1UX1)
CDD_BACSU
[Raw transfer]




THU_C_10(1UX1)
CDD_BACSU
[Raw transfer]




THU_B_5(1UWZ)
CDD_BACSU
[Raw transfer]




TYU_D_13(2FR5)
CDD_MOUSE
[Raw transfer]




THU_A_5(1UX1)
CDD_BACSU
[Raw transfer]




THU_A_3(1UWZ)
CDD_BACSU
[Raw transfer]




TYU_B_11(2FR5)
CDD_MOUSE
[Raw transfer]




TYU_C_12(2FR5)
CDD_MOUSE
[Raw transfer]




CTN_A_10(2FR6)
CDD_MOUSE
[Raw transfer]




THU_D_12(1UX1)
CDD_BACSU
[Raw transfer]




CTN_C_12(2FR6)
CDD_MOUSE
[Raw transfer]




TYU_A_10(2FR5)
CDD_MOUSE
[Raw transfer]




THU_B_6(1JTK)
CDD_BACSU
[Raw transfer]




THU_A_5(1JTK)
CDD_BACSU
[Raw transfer]




CTN_D_13(2FR6)
CDD_MOUSE
[Raw transfer]




BRD_B_6(1MQ0)
CDD_HUMAN
[Raw transfer]




TYU_A_10(2FR5)
CDD_MOUSE
[Raw transfer]




BRD_A_5(1MQ0)
CDD_HUMAN
[Raw transfer]




THU_B_5(1UX0)
CDD_BACSU
[Raw transfer]




URI_B_11(2FR6)
CDD_MOUSE
[Raw transfer]




URD_C_12(1ZAB)
CDD_MOUSE
[Raw transfer]




URD_A_10(1ZAB)
CDD_MOUSE
[Raw transfer]




URD_B_11(1ZAB)
CDD_MOUSE
[Raw transfer]




URD_D_13(1ZAB)
CDD_MOUSE
[Raw transfer]




EDO_A_6(3R2N)
?
[Raw transfer]




EDO_A_6(3OJ6)
BSD_COCIM
[Raw transfer]




MRD_D_13(3DMO)
?
[Raw transfer]




MRD_B_11(3DMO)
?
[Raw transfer]




MRD_A_10(3DMO)
?
[Raw transfer]




MRD_C_12(3DMO)
?
[Raw transfer]




MRD_A_10(3DMO)
?
[Raw transfer]




NH3_B_14(2FR6)
CDD_MOUSE
[Raw transfer]




4 PsiBlast_PDB 97.3898%-117 - C3 -1UX1 3.7 CDD_BACSU
26 PsiBlast_CBE 96.5198%-114 - C3 -1UX1 3.7 CDD_BACSU
24 PsiBlast_CBE 95.8898%-115 - C3 -1UX1 3.6 CDD_BACSU
21 PsiBlast_CBE 94.64100%-114 - C3 -1JTK 3.6 CDD_BACSU
1 PsiBlast_PDB 93.91100%-115 - C3 -1JTK - CDD_BACSU -
25 PsiBlast_CBE 93.7498%-121 - C3 -1UX1 3.6 CDD_BACSU
23 PsiBlast_CBE 92.4999%-113 - C3 -1UWZ 3.6 CDD_BACSU
69 HHSearch 92.4499%-114 - C3 -1UWZ 3.6 CDD_BACSU
3 PsiBlast_PDB 92.4499%-114 - C3 -1UWZ - CDD_BACSU -
2 PsiBlast_PDB 92.0499%-115 - C3 -1UX0 - CDD_BACSU -
22 PsiBlast_CBE 91.8699%-116 - C3 -1UX0 3.9 CDD_BACSU
87 Fugue 84.64100% -56 - C3 -1JTK 3.6 CDD_BACSU
27 PsiBlast_CBE 83.7669%-102 - C3 -2D30 - ? -
68 HHSearch 83.3070% -96 - C3 -2D30 - ? -
5 PsiBlast_PDB 83.0869% -96 - C3 -2D30 - ? -
32 PsiBlast_CBE 70.1750% -43 - C3 -2FR6 3.3 CDD_MOUSE
12 PsiBlast_PDB 69.8935%-112 - C3 -3MPZ - ? -
40 PsiBlast_CBE 69.4150% -54 - C3 -1ZAB 3.5 CDD_MOUSE
31 PsiBlast_CBE 68.9951% -57 - C3 -1MQ0 3.8 CDD_HUMAN
51 PsiBlast_CBE 68.4534%-109 - C3 -4F3W - ? -
9 PsiBlast_PDB 68.2550% -50 - C3 -2FR5 4.0 CDD_MOUSE
38 PsiBlast_CBE 68.2450% -49 - C3 -1ZAB 3.2 CDD_MOUSE
35 PsiBlast_CBE 68.0050% -49 - C3 -2FR5 3.9 CDD_MOUSE
8 PsiBlast_PDB 67.9450% -46 - C3 -1ZAB 3.4 CDD_MOUSE
34 PsiBlast_CBE 67.8350% -50 - C3 -2FR6 3.9 CDD_MOUSE
10 PsiBlast_PDB 67.8150% -49 - C3 -2FR6 3.5 CDD_MOUSE
39 PsiBlast_CBE 67.7850% -48 - C3 -1ZAB 3.7 CDD_MOUSE
37 PsiBlast_CBE 67.5150% -52 - C3 -2FR5 3.9 CDD_MOUSE
36 PsiBlast_CBE 67.2050% -49 - C3 -2FR5 3.8 CDD_MOUSE
7 PsiBlast_PDB 66.6251% -54 - C3 -1MQ0 3.7 CDD_HUMAN
71 HHSearch 66.3348% -51 - C3 -2FR5 4.0 CDD_MOUSE
33 PsiBlast_CBE 63.8350% -45 - C3 -2FR6 3.6 CDD_MOUSE
76 HHSearch 63.5732%-111 * C3 *3R2N 3.6 ?
72 HHSearch 63.5055% -20 - C3 -3DMO 3.1 ?
30 PsiBlast_CBE 50.8757% -7 - C3 -3DMO 3.0 ?
29 PsiBlast_CBE 49.8357% -6 - C3 -3DMO 3.0 ?
28 PsiBlast_CBE 48.9257% -7 - C3 -3DMO 3.0 ?
6 PsiBlast_PDB 48.1257% -8 - C3 -3DMO 3.1 ?
77 HHSearch 48.0232% -50 - C3 -3OJ6 3.7 BSD_COCIM