@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu25660: (2016-07-10 )
MKKLYGVIGNPIGHSMSPDIHNASLKDLGLDGHYHAFKVEENDLEDAVKGIRALGVQGINVTVPHKVSIMDYLDHIDESAKVLGAVNTVRREGDKLVGYNTDGEGFVKSLMKVLDKPISELSFLMIGAGGAARAIFTTIVRNTPKKFDICNRTLEKAKRLTEATPSFHNKEVLSIKEAEERLEQYDVIIHTTSVGMYPNVDDVPLSLQRAASSAVVCDIVYNPIQTALLKEASQKGLKTLDGVGMFVEQAALSFQLWTGQEPNIEKMRSIVIGKLGGTEC

Atome Classification :

(57 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_C_9(2HK9)
AROE_AQUAE
[Raw transfer]




NAP_D_11(2HK9)
AROE_AQUAE
[Raw transfer]




NAP_B_7(2HK9)
AROE_AQUAE
[Raw transfer]




NAP_A_6(2O7S)
DHQSD_ARATH
[Raw transfer]




NAP_A_19(1NYT)
AROE_ECOLI
[Raw transfer]




NAP_D_23(1NYT)
AROE_ECOLI
[Raw transfer]




NAP_A_19(1NYT)
AROE_ECOLI
[Raw transfer]




NAD_A_5(3TNL)
AROE_LISMO
[Raw transfer]




NAP_B_21(1NYT)
AROE_ECOLI
[Raw transfer]




NAD_A_5(3TNL)
AROE_LISMO
[Raw transfer]




ATR_A_5(2HK9)
AROE_AQUAE
[Raw transfer]




NAP_C_22(1NYT)
AROE_ECOLI
[Raw transfer]




NAD_C_10(3TNL)
AROE_LISMO
[Raw transfer]




NDP_A_5(3SEF)
AROE_VIBCH
[Raw transfer]




NAP_A_5(1NVT)
AROE_METJA
[Raw transfer]




NDP_B_6(3PHI)
AROE_HELPY
[Raw transfer]




NAD_D_13(3TNL)
AROE_LISMO
[Raw transfer]




NDP_B_6(3SEF)
AROE_VIBCH
[Raw transfer]




NAD_B_8(3TNL)
AROE_LISMO
[Raw transfer]




NAD_A_3(3T4E)
YDIB_SALTY
[Raw transfer]




NDP_A_4(3PHI)
AROE_HELPY
[Raw transfer]




NAD_A_3(1O9B)
YDIB_ECOLI
[Raw transfer]




SKM_A_2(3PHH)
AROE_HELPY
[Raw transfer]




SKM_A_2(3PHH)
AROE_HELPY
[Raw transfer]




DHK_A_3(3PHJ)
AROE_HELPY
[Raw transfer]




SKM_B_4(4FR5)
AROE_HELPY
[Raw transfer]




SKM_E_5(2GPT)
DHQSD_ARATH
[Raw transfer]




DHK_A_5(2O7S)
DHQSD_ARATH
[Raw transfer]




SKM_D_8(3PGJ)
AROE_VIBCH
[Raw transfer]




SKM_A_2(4FOS)
AROE_HELPY
[Raw transfer]




SKM_A_3(4FSH)
AROE_HELPY
[Raw transfer]




SKM_B_6(3PGJ)
AROE_VIBCH
[Raw transfer]




SKM_A_2(3DOO)
AROE_STAEQ
[Raw transfer]




DHK_B_4(3PHJ)
AROE_HELPY
[Raw transfer]




SKM_A_5(2EV9)
AROE_THET8
[Raw transfer]




SKM_A_5(3PGJ)
AROE_VIBCH
[Raw transfer]




SKM_B_6(2EV9)
AROE_THET8
[Raw transfer]




SKM_B_8(2D5C)
AROE_THET8
[Raw transfer]




SKM_A_7(2D5C)
AROE_THET8
[Raw transfer]




SKM_C_7(3PGJ)
AROE_VIBCH
[Raw transfer]




SKM_C_8(3SEF)
AROE_VIBCH
[Raw transfer]




SKM_A_7(2D5C)
AROE_THET8
[Raw transfer]




SKM_A_3(4FR5)
AROE_HELPY
[Raw transfer]




SKM_B_4(4FQ8)
AROE_HELPY
[Raw transfer]




SKM_A_3(4FQ8)
AROE_HELPY
[Raw transfer]




DTV_A_20(1NYT)
AROE_ECOLI
[Raw transfer]




1 PsiBlast_PDB 89.1445%-111 - C6 -2EGG - AROE_GEOKA -
120 HHSearch 87.9041%-120 - C6 -2HK9 - AROE_AQUAE -
5 PsiBlast_PDB 85.9942%-123 - C6 -2HK7 - AROE_AQUAE -
25 PsiBlast_CBE 85.9242%-126 - C6 -2HK7 - AROE_AQUAE -
114 HHSearch 85.8842%-109 - C6 -3DON - AROE_STAEQ -
6 PsiBlast_PDB 85.6842%-122 - C6 -2HK8 - AROE_AQUAE -
24 PsiBlast_CBE 85.6042%-119 - C6 -2HK9 9.8 AROE_AQUAE
7 PsiBlast_PDB 85.5342%-122 - C6 -2HK9 6.5 AROE_AQUAE
2 PsiBlast_PDB 85.4742%-113 - C6 -3DON - AROE_STAEQ -
23 PsiBlast_CBE 84.7942%-116 - C6 -2HK9 10.3 AROE_AQUAE
22 PsiBlast_CBE 84.4942%-114 - C6 -2HK9 10.7 AROE_AQUAE
3 PsiBlast_PDB 84.2642%-116 - C6 -3DOO 3.4 AROE_STAEQ
109 HHSearch 79.0043% -56 - C6 -1NVT 7.9 AROE_METJA
36 PsiBlast_CBE 77.2734%-116 - C6 -5DZS - ? -
106 HHSearch 77.0033%-100 * C6 *2D5C 3.6 AROE_THET8
4 PsiBlast_PDB 75.9240% -55 - C6 -1NVT - AROE_METJA -
113 HHSearch 75.5834%-100 - C6 -3FBT - ? -
104 HHSearch 75.5331%-106 - C6 -5DZS - ? -
37 PsiBlast_CBE 75.4334%-114 - C6 -5DZS - ? -
21 PsiBlast_CBE 75.4140% -60 - C6 -1NVT - AROE_METJA -
16 PsiBlast_PDB 74.5233% -44 - C6 -1O9B 6.3 YDIB_ECOLI
9 PsiBlast_PDB 74.0935% -51 - C6 -3TNL 6.9 AROE_LISMO
34 PsiBlast_CBE 73.7835% -50 - C6 -3TNL 6.9 AROE_LISMO
102 HHSearch 73.6134% -38 - C6 -3TNL 7.3 AROE_LISMO
35 PsiBlast_CBE 73.1235% -47 - C6 -3TNL 7.0 AROE_LISMO
33 PsiBlast_CBE 72.9135% -48 - C6 -3TNL 7.0 AROE_LISMO
54 PsiBlast_CBE 72.8734% -40 - C6 -1NYT 8.3 AROE_ECOLI
53 PsiBlast_CBE 72.6934% -44 - C6 -1NYT 7.3 AROE_ECOLI
55 PsiBlast_CBE 72.6234% -40 - C6 -1NYT 8.2 AROE_ECOLI
56 PsiBlast_CBE 72.3834% -39 - C6 -1NYT 8.8 AROE_ECOLI
107 HHSearch 71.5533% -44 - C6 -1NYT 10.3 AROE_ECOLI
101 HHSearch 71.3232% -42 - C6 -3T4E 7.6 YDIB_SALTY
45 PsiBlast_CBE 70.4437% -34 - C6 -3PGJ 3.8 AROE_VIBCH
43 PsiBlast_CBE 70.2937% -32 - C6 -3SEF 6.3 AROE_VIBCH
48 PsiBlast_CBE 70.1632% -88 - C6 -2D5C 3.6 AROE_THET8
115 HHSearch 70.0036% -24 - C6 -2O7S 9.7 DHQSD_ARATH
12 PsiBlast_PDB 69.8137% -31 - C6 -3PGJ 3.2 AROE_VIBCH
19 PsiBlast_PDB 69.7132% -62 - C6 -2D5C 3.6 AROE_THET8
44 PsiBlast_CBE 69.5537% -29 - C6 -3PGJ 3.2 AROE_VIBCH
20 PsiBlast_PDB 69.2632% -62 - C6 -2EV9 3.4 AROE_THET8
46 PsiBlast_CBE 68.8637% -30 - C6 -3PGJ 3.2 AROE_VIBCH
47 PsiBlast_CBE 68.7132% -62 - C6 -2EV9 3.3 AROE_THET8
42 PsiBlast_CBE 66.6637% -38 - C6 -3SEF 3.2 AROE_VIBCH
13 PsiBlast_PDB 66.5137% -27 - C6 -3SEF 5.6 AROE_VIBCH
58 PsiBlast_CBE 62.9832% -11 - C6 -2GPT 3.7 DHQSD_ARATH
117 HHSearch 56.8131% 5 - C6 -3PHH 4.0 AROE_HELPY
62 PsiBlast_CBE 54.9132% 33 - C6 -3PHI 5.4 AROE_HELPY
61 PsiBlast_CBE 54.1632% 35 - C6 -3PHI 6.1 AROE_HELPY
66 PsiBlast_CBE 53.5532% 28 - C6 -4FQ8 3.7 AROE_HELPY
67 PsiBlast_CBE 53.4732% 28 - C6 -4FQ8 3.3 AROE_HELPY
60 PsiBlast_CBE 53.4432% 33 - C6 -3PHJ 4.0 AROE_HELPY
64 PsiBlast_CBE 52.7432% 28 - C6 -4FR5 3.5 AROE_HELPY
63 PsiBlast_CBE 52.5332% 35 - C6 -3PHH 4.0 AROE_HELPY
65 PsiBlast_CBE 52.5232% 27 - C6 -4FR5 3.6 AROE_HELPY
59 PsiBlast_CBE 52.4332% 34 - C6 -3PHJ 4.1 AROE_HELPY
68 PsiBlast_CBE 52.2032% 41 - C6 -4FOS 3.5 AROE_HELPY
69 PsiBlast_CBE 49.4731% 30 - C6 -4FSH 3.8 AROE_HELPY