@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu26800: (2016-07-11 )
MNEFMKKFSLTKPIIQAPMAGGITKPRLASAVSNQGALGSLASGYLTPDLLEQQIKEIFELTDAPFQINVFVPLGLEMPPKDQIKKWKENIPLANQVNQFTSVQEEWDDFYQKIDLILKYKVKACSFTFDLPPEDAVKELKTAGCCLIGTASTVEEALLMEERGMDIVVLQGSEAGGHRGAFLPSKGESAVGLMALIPQAADALSVPVIAAGGMIDHRGVKAALTLGAQGVQIGSAFLICHESNAHPVHKQKILEANEADTKLTTLFSGKEARGIVNKWMEENEQFETQTLPYPYQNTLTKAMRQKASLQNNHDQMSLWAGQGIRSLTEEISVKQLLNQLCQEDIKI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_B_5(4QIU)
?
[Raw transfer]




FMN_A_3(4QIS)
?
[Raw transfer]




FMN_A_3(4QIT)
?
[Raw transfer]




FMN_B_4(4QIS)
?
[Raw transfer]




FMN_A_3(4QIU)
?
[Raw transfer]




FMN_B_4(4Q4K)
?
[Raw transfer]




FMN_B_5(4QIT)
?
[Raw transfer]




FMN_A_3(4QIT)
?
[Raw transfer]




FMN_A_3(4Q4K)
?
[Raw transfer]




35 HHSearch 78.0131% -99 - C2 -3BO9 - ? -
3 PsiBlast_PDB 76.6536% -0 - C2 -4QIT 3.4 ?
24 PsiBlast_CBE 76.1736% 3 - C2 -4QIU 4.1 ?
23 PsiBlast_CBE 75.9536% 5 - C2 -4QIT 3.5 ?
4 PsiBlast_PDB 75.5636% 3 - C2 -4QIU 4.1 ?
22 PsiBlast_CBE 75.4436% 5 - C2 -4Q4K 3.6 ?
21 PsiBlast_CBE 75.4036% 3 - C2 -4QIS 4.3 ?
31 HHSearch 75.0037% -1 - C2 -4QIT 9.2 ?
2 PsiBlast_PDB 73.5836% 4 - C2 -4Q4K 3.8 ?
32 HHSearch 73.4832% -84 * C2 *2Z6I - ? -
1 PsiBlast_PDB 73.2436% 6 - C2 -4QIS 3.9 ?
6 PsiBlast_PDB 71.5028% -98 - C2 -3BO9 - ? -
33 HHSearch 71.2030% -74 - C2 -4IQL - ? -
9 PsiBlast_PDB 66.9528% -76 - C2 -2Z6I - ? -
5 PsiBlast_PDB 63.1629% -73 - C2 -2Z6J - ? -
25 PsiBlast_CBE 62.8232% -52 - C2 -4IQL - ? -
55 Fugue 61.9727% 2 - C2 -2GJL - 2NPD_PSEAE -
10 PsiBlast_PDB 61.7432% -52 - C2 -4IQL - ? -
34 HHSearch 61.1529% -26 - C2 -2GJL - 2NPD_PSEAE -
8 PsiBlast_PDB 60.6027% -8 - C2 -2GJN - 2NPD_PSEAE -