@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu26810: (2016-07-11 )
MKIGFFDSGIGGMTVLYEAIKVLPYEDYIFYADTLNVPYGEKSKGKVKEYIFNAAEFLASQNIKALVIACNTATSIAIEDLRRNFDFPIIGIEPAVKPAINKCTEERKRVLVVATNLTLKEEKFHNLVKEIDHHDLVDCLALPGLVEFAENFDFSEDKIIKYLKNELSSFDLKQYGTIVLGCTHFPFFKNSFEKLFGIKVDMISGSVGTAKQLKKVLADRNQLGKGSGSITFFNSGHKIVDQEVISKYKRLFEILDETQRSHVGH

Atome Classification :

(48 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DGL_B_4(2JFX)
MURI_HELPJ
[Raw transfer]




DGL_B_4(2JFY)
MURI_HELPJ
[Raw transfer]




DGL_B_5(2JFP)
MURI_ENTFA
[Raw transfer]




DGL_A_5(2W4I)
MURI_HELPJ
[Raw transfer]




DGL_F_10(2W4I)
MURI_HELPJ
[Raw transfer]




GLU_A_3(2JFO)
MURI_ENTFA
[Raw transfer]




DGL_A_3(2JFY)
MURI_HELPJ
[Raw transfer]




DGL_B_4(2JFQ)
MURI_STAAR
[Raw transfer]




DGL_B_6(2W4I)
MURI_HELPJ
[Raw transfer]




DGL_A_3(2JFP)
MURI_ENTFA
[Raw transfer]




DGL_B_5(4B1F)
MURI_HELPJ
[Raw transfer]




DGL_A_3(2JFQ)
MURI_STAAR
[Raw transfer]




DGL_A_4(4B1F)
MURI_HELPJ
[Raw transfer]




DGL_A_3(2JFX)
MURI_HELPJ
[Raw transfer]




DGL_A_3(2JFQ)
MURI_STAAR
[Raw transfer]




DGL_B_6(2JFZ)
MURI_HELPJ
[Raw transfer]




DGL_E_8(2W4I)
MURI_HELPJ
[Raw transfer]




DGL_B_6(2VVT)
MURI_ENTFA
[Raw transfer]




DGL_A_4(2JFZ)
MURI_HELPJ
[Raw transfer]




DGL_E_5(1ZUW)
MURI1_BACSU
[Raw transfer]




DGL_A_4(2VVT)
MURI_ENTFA
[Raw transfer]




DGL_H_8(1ZUW)
MURI1_BACSU
[Raw transfer]




DGL_F_6(1ZUW)
MURI1_BACSU
[Raw transfer]




DGL_B_4(2JFO)
MURI_ENTFA
[Raw transfer]




DGL_B_8(3UHO)
MURI_CAMJE
[Raw transfer]




DGL_B_8(3UHF)
MURI_CAMJE
[Raw transfer]




DGL_A_3(3UHF)
MURI_CAMJE
[Raw transfer]




DGL_A_3(3UHO)
MURI_CAMJE
[Raw transfer]




GLU_A_2(2JFN)
MURI_ECOLI
[Raw transfer]




TLA_A_2(2JFW)
?
[Raw transfer]




SIN_A_3(3IST)
MURI_LISMO
[Raw transfer]




SIN_A_3(3IST)
MURI_LISMO
[Raw transfer]




FLC_A_3(2JFV)
?
[Raw transfer]




DGN_C_3(1B74)
MURI_AQUPY
[Raw transfer]




DGN_C_3(1B74)
MURI_AQUPY
[Raw transfer]




NHL_A_2(2OHV)
MURI_STRP1
[Raw transfer]




61 HHSearch 91.0829%-129 - C5 -2VVT - MURI_ENTFA -
60 HHSearch 87.8631% -65 - C5 -2JFQ 4.5 MURI_STAAR
3 PsiBlast_PDB 87.6732% -85 - C5 -2JFV 4.8 ?
59 HHSearch 86.9230% -70 - C5 -2GZM - ? -
4 PsiBlast_PDB 86.9132% -83 - C5 -2JFW 3.3 ?
57 HHSearch 86.7529%-130 * C5 *2DWU - ? -
2 PsiBlast_PDB 86.4932% -85 - C5 -2JFU - ? -
8 PsiBlast_PDB 84.5332% -68 - C5 -3ISV - MURI_LISMO -
1 PsiBlast_PDB 84.3131% -71 - C5 -2GZM - ? -
23 PsiBlast_CBE 84.2331% -66 - C5 -2GZM - ? -
22 PsiBlast_CBE 83.9731% -70 - C5 -2GZM - ? -
66 HHSearch 83.8129% -80 - C5 -2OHO - MURI_STRP1 -
62 HHSearch 83.3430% -64 - C5 -3IST 3.9 MURI_LISMO
6 PsiBlast_PDB 83.1832% -65 - C5 -3HFR - MURI_LISMO -
32 PsiBlast_CBE 83.0633%-125 - C5 -3UHF 4.3 MURI_CAMJE
16 PsiBlast_PDB 82.4633%-121 - C5 -3UHF 4.3 MURI_CAMJE
31 PsiBlast_CBE 82.3233%-120 - C5 -3UHO 3.8 MURI_CAMJE
21 PsiBlast_CBE 82.3231% -68 - C5 -2GZM - ? -
63 HHSearch 82.2329% -80 - C5 -3UHF - MURI_CAMJE -
17 PsiBlast_PDB 82.0633%-121 - C5 -3UHO 4.1 MURI_CAMJE
7 PsiBlast_PDB 81.6832% -64 - C5 -3IST 3.9 MURI_LISMO
24 PsiBlast_CBE 81.5635% -71 - C5 -2JFQ 4.3 MURI_STAAR
5 PsiBlast_PDB 80.5935% -72 - C5 -2JFQ 4.5 MURI_STAAR
12 PsiBlast_PDB 80.4134% -88 - C5 -2JFP 4.4 MURI_ENTFA
11 PsiBlast_PDB 80.1934% -87 - C5 -2JFO 4.6 MURI_ENTFA
48 Fugue 80.0930% -65 - C5 -1B74 2.4 MURI_AQUPY
28 PsiBlast_CBE 78.9734% -88 - C5 -2JFP 4.3 MURI_ENTFA
10 PsiBlast_PDB 78.6334% -80 - C5 -2VVT 4.5 MURI_ENTFA
29 PsiBlast_CBE 78.0434% -83 - C5 -2JFO 3.7 MURI_ENTFA
15 PsiBlast_PDB 77.6831%-102 - C5 -2OHV 4.4 MURI_STRP1
27 PsiBlast_CBE 76.5334% -81 - C5 -2VVT 4.5 MURI_ENTFA
33 PsiBlast_CBE 75.5832% -69 - C5 -1B74 2.4 MURI_AQUPY
45 PsiBlast_CBE 72.4431% -89 - C5 -2JFX 4.4 MURI_HELPJ
35 PsiBlast_CBE 72.4031% -84 - C5 -4B1F 4.4 MURI_HELPJ
36 PsiBlast_CBE 71.4331% -83 - C5 -2W4I 4.6 MURI_HELPJ
42 PsiBlast_CBE 71.2231% -85 - C5 -2JFY 4.8 MURI_HELPJ
43 PsiBlast_CBE 71.1431% -87 - C5 -2JFY 4.7 MURI_HELPJ
40 PsiBlast_CBE 70.8431% -86 - C5 -2JFZ 4.2 MURI_HELPJ
41 PsiBlast_CBE 70.2631% -85 - C5 -2JFZ 4.4 MURI_HELPJ
37 PsiBlast_CBE 69.9031% -87 - C5 -2W4I 4.5 MURI_HELPJ
44 PsiBlast_CBE 69.7031% -85 - C5 -2JFX 5.1 MURI_HELPJ
39 PsiBlast_CBE 69.3931% -84 - C5 -2W4I 4.7 MURI_HELPJ
38 PsiBlast_CBE 69.3931% -83 - C5 -2W4I 4.3 MURI_HELPJ
34 PsiBlast_CBE 68.6731% -87 - C5 -4B1F 4.4 MURI_HELPJ
9 PsiBlast_PDB 68.2832% -16 - C5 -1ZUW 4.4 MURI1_BACSU
25 PsiBlast_CBE 67.8832% -20 - C5 -1ZUW 4.6 MURI1_BACSU
26 PsiBlast_CBE 67.3432% -19 - C5 -1ZUW 4.2 MURI1_BACSU
46 PsiBlast_CBE 59.5536% -54 - C5 -2JFN 7.3 MURI_ECOLI