@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu27000: (2016-07-12 )
MNIAQVAKQFGLTAATLRYYERVGLIPPVKRKDSGIRDYDEEDIKWIEFIKCMRNAGLSIEALIEYTTLFTEGDRTVEARKNILADERQRLIEKRKEIDETIKRLDTKIKDYDGKLRENEAKLKSRPKTESLHGSVEQRR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_B_4(3GP4)
?
[Raw transfer]




GOL_A_3(3GP4)
?
[Raw transfer]




21 PsiBlast_CBE 90.7446%-147 - C2 -3GP4 2.7 ?
1 PsiBlast_PDB 90.3946%-137 - C2 -3GP4 - ? -
40 HHSearch 89.9144%-138 - C2 -3GP4 3.0 ?
43 HHSearch 73.5029%-178 - C2 -3GPV - ? -
5 PsiBlast_PDB 73.3832%-134 - C2 -1Q07 - CUER_ECOLI -
2 PsiBlast_PDB 72.0529%-186 - C2 -3GPV - ? -
3 PsiBlast_PDB 71.9632%-120 - C2 -1Q05 - CUER_ECOLI -
4 PsiBlast_PDB 70.7532%-128 - C2 -1Q06 - CUER_ECOLI -
7 PsiBlast_PDB 69.7932%-129 - C2 -4WLW - CUER_ECOLI -
22 PsiBlast_CBE 69.6932%-128 - C2 -1Q07 - CUER_ECOLI -
23 PsiBlast_CBE 69.5032%-132 - C2 -1Q06 - CUER_ECOLI -
14 PsiBlast_PDB 69.1423%-166 - C2 -3HH0 - ? -
24 PsiBlast_CBE 68.8032%-129 - C2 -1Q05 - CUER_ECOLI -
49 HHSearch 66.3927%-173 - C2 -3QAO - ? -
6 PsiBlast_PDB 65.9032%-130 - C- -4WLS - CUER_ECOLI -
47 HHSearch 65.3825%-165 - C2 -1R8D - MTA_BACSU -
10 PsiBlast_PDB 64.7327%-175 - C2 -1JBG - MTA_BACSU -
11 PsiBlast_PDB 62.9327%-148 - C2 -1R8D - MTA_BACSU -
12 PsiBlast_PDB 62.2329%-143 - C2 -3QAO - ? -
45 HHSearch 61.9221%-181 - C2 -3HH0 - ? -