@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu27030: (2016-07-12 )
MKKRLIQVMIMFTLLLTMAFSADAADSSYYDEDYRPQYHFTPEANWMNDPNGMVYYAGEYHLFYQYHPYGLQWGPMHWGHAVSKDLVTWEHLPVALYPDEKGTIFSGSAVVDKNNTSGFQTGKEKPLVAIYTQDREGHQVQSIAYSNDKGRTWTKYAGNPVIPNPGKKDFRDPKVFWYEKEKKWVMVLAAGDRILIYTSKNLKQWTYASEFGQDQGSHGGVWECPDLFELPVDGNPNQKKWVMQVSVGNGAVSGGSGMQYFVGDFDGTHFKNENPPNKVLWTDYGRDFYAAVSWSDIPSTDSRRLWLGWMSNWQYANDVPTSPWRSATSIPRELKLKAFTEGVRVVQTPVKELETIRGTSKKWKNLTISPASHNVLAGQSGDAYEINAEFKVSPGSAAEFGFKVRTGENQFTKVGYDRRNAKLFVDRSESGNDTFNPAFNTGKETAPLKPVNGKVKLRIFVDRSSVEVFGNDGKQVITDIILPDRSSKGLELYAANGGVKVKSLTIHPLKKVWGTTPFMSNMTGWTTVNGTWADTIEGKQGRSDGDSFILSSASGSDFTYESDITIKDGNGRGAGALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRLVIDAHDSVFSEGQFGLNVWDATAVFQNVTKES

Atome Classification :

(32 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FRU_A_3(3KF3)
INV_SCHOC
[Raw transfer]




FRU_A_3(3KF3)
INV_SCHOC
[Raw transfer]




FRU_A_3(3PIJ)
?
[Raw transfer]




FRU_A_3(3KF3)
INV_SCHOC
[Raw transfer]




FRU_B_8(3KF3)
INV_SCHOC
[Raw transfer]




FRU_B_6(3PIJ)
?
[Raw transfer]




FRU_A_3(3PIJ)
?
[Raw transfer]




SUGAR_B_8(3U14)
?
[Raw transfer]

-

SUGAR_A_3(3U14)
?
[Raw transfer]

-

GOL_D_4(1ST8)
?
[Raw transfer]




GOL_E_5(2AC1)
INV1_ARATH
[Raw transfer]




GOL_A_9(3KF5)
INV_SCHOC
[Raw transfer]




GOL_G_7(1Y4W)
INUE_ASPAW
[Raw transfer]




GOL_F_6(2AC1)
INV1_ARATH
[Raw transfer]




GOL_F_6(1ST8)
?
[Raw transfer]




MAN_X_2(3SC7)
INU2_ASPFI
[Raw transfer]




MAN_X_9(3RWK)
INU2_ASPFI
[Raw transfer]




51 HHSearch 85.4238% 18 * C3 *3SC7 - INU2_ASPFI -
7 PsiBlast_PDB 83.2035% 20 - C3 -3SC7 2.8 INU2_ASPFI
57 HHSearch 82.0433% 3 - C3 -4FFH - ? -
8 PsiBlast_PDB 81.0035% 23 - C3 -3RWK 2.8 INU2_ASPFI
52 HHSearch 80.9844% 50 - C3 -1Y4W 3.0 INUE_ASPAW
1 PsiBlast_PDB 79.9641% 46 - C3 -1Y9M - INUE_ASPAW -
3 PsiBlast_PDB 79.3341% 44 - C3 -1Y4W - INUE_ASPAW -
19 PsiBlast_PDB 79.2231% 15 - C3 -4FFI - ? -
18 PsiBlast_PDB 78.8331% 17 - C3 -4FFH - ? -
36 PsiBlast_CBE 78.3331% 16 - C3 -4FFI - ? -
38 PsiBlast_CBE 78.3231% 14 - C3 -4FFH - ? -
2 PsiBlast_PDB 78.2641% 44 - C3 -1Y9G - INUE_ASPAW -
35 PsiBlast_CBE 78.1031% 17 - C3 -4FFI - ? -
39 PsiBlast_CBE 78.0931% 15 - C3 -4FFH - ? -
34 PsiBlast_CBE 78.0831% 14 - C3 -4FFI - ? -
37 PsiBlast_CBE 77.6931% 13 - C3 -4FFH - ? -
33 PsiBlast_CBE 77.6131% 17 - C3 -4FFG - ? -
16 PsiBlast_PDB 77.5631% 15 - C3 -4FFF - ? -
17 PsiBlast_PDB 77.4031% 17 - C3 -4FFG - ? -
32 PsiBlast_CBE 76.8631% 16 - C3 -4FFG - ? -
53 HHSearch 71.5537% 56 - C3 -3KF3 3.6 INV_SCHOC
71 Fugue 70.2837% 53 - C3 -3KF3 3.6 INV_SCHOC
11 PsiBlast_PDB 70.0538% 58 - C3 -3KF5 3.1 INV_SCHOC
12 PsiBlast_PDB 69.9338% 59 - C3 -3KF3 3.6 INV_SCHOC
56 HHSearch 69.4433% 39 - C3 -3PIJ 4.0 ?
26 PsiBlast_CBE 69.0538% 60 - C3 -3U14 6.4 ?
28 PsiBlast_CBE 69.0338% 56 - C3 -3KF3 3.8 INV_SCHOC
10 PsiBlast_PDB 68.8938% 60 - C3 -3U14 6.6 ?
61 HHSearch 68.3630% 35 - C3 -1ST8 2.8 ?
15 PsiBlast_PDB 68.2631% 36 - C3 -3PIJ 4.0 ?
58 HHSearch 68.1931% 41 - C3 -2AC1 2.7 INV1_ARATH
29 PsiBlast_CBE 68.0631% 35 - C3 -3PIJ 4.0 ?