@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu27260: (2016-07-12 )
MTVITDITELIGNTPLLRLKNFDVPEGVAVYAKLEMMNPGGSIKDRLGDMLIRDALDSGKVKPGGVIIEATAGNTGIGLALSARKYGLKAIFCVPEHFSREKQQIMQALGASIIHTPRQDGMQGAIQKAIQLETEIENSYCVLQFKNRVNPSTYYKTLGPEMWEALDGNIHTFVAGAGSGGTFAGTASFLKEKNPAVKTVIVEPVGSILNGGEPHAHKTEGIGMEFIPDYMDKSHFDEIYTVTDENAFRLVKEAAEKEGLLIGSSSGAALYAALEEAKKASAGTNIVTVFPDSSDRYISKQIYEGGI

Atome Classification :

(70 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

KOU_A_3(3PC4)
?
[Raw transfer]




P1T_A_3(3PC3)
?
[Raw transfer]




P1T_A_3(3PC3)
?
[Raw transfer]




PDA_A_2(2Q3D)
CYSK_MYCTU
[Raw transfer]




AA5_A_2(1Z7Y)
CYSK1_ARATH
[Raw transfer]




CYS_A_2(4LMB)
?
[Raw transfer]




4AT_B_6(2EFY)
?
[Raw transfer]




CYS_B_11(3BM5)
?
[Raw transfer]




4AT_A_4(2EFY)
?
[Raw transfer]




AWH_A_3(3ZEI)
CYSK_MYCTU
[Raw transfer]




PLP_E_5(1D6S)
CYSK_SALTY
[Raw transfer]




PLP_D_4(1D6S)
CYSK_SALTY
[Raw transfer]




CHAIN_B_2(2Q3C)
CYSK_MYCTU
[Raw transfer]

-

CIT_A_4(2V03)
CYSM_ECOLI
[Raw transfer]




4MV_A_3(2ECO)
?
[Raw transfer]




PLP_B_10(3BM5)
?
[Raw transfer]




PLP_B_5(4L0D)
CBS_HUMAN
[Raw transfer]




PLP_A_3(4L0D)
CBS_HUMAN
[Raw transfer]




FGA_B_11(4AIR)
?
[Raw transfer]




PLP_B_7(4LMA)
?
[Raw transfer]




PLP_B_15(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_D_16(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_A_2(2ECO)
?
[Raw transfer]




PLP_B_6(2PQM)
?
[Raw transfer]




PLP_A_2(2ECQ)
?
[Raw transfer]




PLP_A_3(1Z7W)
CYSK1_ARATH
[Raw transfer]




PLP_B_5(2EFY)
?
[Raw transfer]




PLP_A_3(3PC2)
?
[Raw transfer]




PLP_A_3(4AEC)
CYSKM_ARATH
[Raw transfer]




PLP_B_4(1OAS)
CYSK_SALTY
[Raw transfer]




PLP_A_3(1OAS)
CYSK_SALTY
[Raw transfer]




PLP_A_5(4COO)
CBS_HUMAN
[Raw transfer]




PLP_A_13(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_A_9(3BM5)
?
[Raw transfer]




PLP_B_5(4AEC)
CYSKM_ARATH
[Raw transfer]




PLP_A_5(2PQM)
?
[Raw transfer]




PLP_B_6(3VBE)
?
[Raw transfer]




PLP_A_3(4AEC)
CYSKM_ARATH
[Raw transfer]




PLP_A_3(1VE1)
?
[Raw transfer]




PLP_A_3(1Z7W)
CYSK1_ARATH
[Raw transfer]




PLP_A_5(2PQM)
?
[Raw transfer]




PLP_A_4(4LMB)
?
[Raw transfer]




PLP_B_18(4COO)
CBS_HUMAN
[Raw transfer]




PLP_A_3(1OAS)
CYSK_SALTY
[Raw transfer]




PLP_A_3(2EFY)
?
[Raw transfer]




PLP_A_3(1VE1)
?
[Raw transfer]




PLP_C_7(3VBE)
?
[Raw transfer]




PLP_A_4(4PCU)
CBS_HUMAN
[Raw transfer]




PLP_A_4(4LMB)
?
[Raw transfer]




PLP_B_7(4PCU)
CBS_HUMAN
[Raw transfer]




PLP_C_14(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_A_5(4LMA)
?
[Raw transfer]




PLP_A_5(3VBE)
?
[Raw transfer]




PLP_A_7(2ISQ)
CYSK1_ARATH
[Raw transfer]




PLP_C_9(2BHS)
CYSM_ECOLI
[Raw transfer]




PLP_A_4(3DWG)
CYSM_MYCTU
[Raw transfer]




PLP_D_11(2BHS)
CYSM_ECOLI
[Raw transfer]




PLP_D_8(3VBE)
?
[Raw transfer]




PLP_B_8(2BHS)
CYSM_ECOLI
[Raw transfer]




PLP_A_7(2BHS)
CYSM_ECOLI
[Raw transfer]




MPD_A_6(2Q3B)
CYSK_MYCTU
[Raw transfer]




OAS_B_3(5HBG)
CYSM_HELPY
[Raw transfer]




3HL_A_3(2ECQ)
?
[Raw transfer]




FGA_B_10(4AIR)
?
[Raw transfer]




MPD_A_6(2Q3B)
CYSK_MYCTU
[Raw transfer]




CHAIN_P_3(1Y7L)
CYSK_HAEIN
[Raw transfer]

-

CHAIN_B_2(3T4P)
?
[Raw transfer]

-

CHAIN_B_3(2ISQ)
CYSK1_ARATH
[Raw transfer]

-

CHAIN_B_2(3TBH)
?
[Raw transfer]

-

CHAIN_B_2(3TBH)
?
[Raw transfer]

-

1 PsiBlast_PDB 80.1253% 24 - C2 -4R2V - CYSM_HELPY -
21 PsiBlast_CBE 79.2353% 32 - C2 -5HBG 2.3 CYSM_HELPY
4 PsiBlast_PDB 78.9041% -52 - C2 -2Q3D 7.9 CYSK_MYCTU
2 PsiBlast_PDB 78.8853% 24 - C2 -5HBG - CYSM_HELPY -
22 PsiBlast_CBE 78.8040%-103 - C2 -4I1Y - ? -
3 PsiBlast_PDB 78.4441% -56 - C2 -3ZEI 6.1 CYSK_MYCTU
11 PsiBlast_PDB 78.3740% -98 - C2 -4I1Y - ? -
5 PsiBlast_PDB 77.7740% -53 - C2 -2Q3B 2.4 CYSK_MYCTU
121 HHSearch 77.7042% -28 - C2 -1O58 - ? -
111 HHSearch 77.3253% 27 - C2 -4R2V - CYSM_HELPY -
6 PsiBlast_PDB 76.3540% -56 - C2 -2Q3C 3.4 CYSK_MYCTU
117 HHSearch 76.0944% 19 - C2 -1Z7W 4.2 CYSK1_ARATH
85 PsiBlast_CBE 75.7935% -54 - C2 -2JC3 - CYSM_SALTY -
9 PsiBlast_PDB 75.7744% 14 - C2 -1Z7W 4.2 CYSK1_ARATH
79 PsiBlast_CBE 75.5635% -52 - C2 -2BHS 3.7 CYSM_ECOLI
10 PsiBlast_PDB 75.2544% 16 - C2 -2ISQ 5.4 CYSK1_ARATH
12 PsiBlast_PDB 75.1344% 17 - C2 -1Z7Y 3.4 CYSK1_ARATH
7 PsiBlast_PDB 75.0241% -64 - C- -3RR2 - ? -
81 PsiBlast_CBE 74.7335% -50 - C2 -2BHS 3.6 CYSM_ECOLI
124 HHSearch 74.5238% -7 - C2 -3TBH 1.8 ?
115 HHSearch 74.0342% 3 - C2 -2Q3B 1.4 CYSK_MYCTU
90 PsiBlast_CBE 73.7838% -10 - C2 -1D6S 4.9 CYSK_SALTY
128 HHSearch 73.5239% 20 - C2 -3PC3 8.2 ?
80 PsiBlast_CBE 73.4935% -48 - C2 -2BHS 3.8 CYSM_ECOLI
91 PsiBlast_CBE 73.3738% -10 - C2 -1D6S 5.1 CYSK_SALTY
50 PsiBlast_CBE 73.1340% 12 - C2 -2EFY 3.4 ?
98 PsiBlast_CBE 73.0237% -5 - C2 -3TBH 1.8 ?
78 PsiBlast_CBE 72.9935% -51 - C2 -2BHS 3.5 CYSM_ECOLI
64 PsiBlast_CBE 72.6639% 6 - C2 -3VBE 3.8 ?
116 HHSearch 72.5342% 21 - C2 -4AEC 4.3 CYSKM_ARATH
73 PsiBlast_CBE 72.0939% -6 - C2 -1OAS 3.9 CYSK_SALTY
51 PsiBlast_CBE 71.9640% 9 - C2 -2EFY 3.5 ?
54 PsiBlast_CBE 71.9540% 10 - C2 -1VE1 3.8 ?
99 PsiBlast_CBE 71.8937% -1 - C2 -3T4P 0.8 ?
55 PsiBlast_CBE 71.8939% 16 - C2 -4LMA 4.2 ?
52 PsiBlast_CBE 71.7840% 12 - C2 -2ECQ 4.2 ?
42 PsiBlast_CBE 71.7240% 7 - C2 -4AEC 4.3 CYSKM_ARATH
63 PsiBlast_CBE 71.6639% 7 - C2 -3VBE 4.4 ?
102 Fugue 71.4339% -10 - C2 -1OAS 3.9 CYSK_SALTY
72 PsiBlast_CBE 71.3739% -7 - C2 -1OAS 4.1 CYSK_SALTY
56 PsiBlast_CBE 71.1439% 17 - C2 -4LMA 3.9 ?
43 PsiBlast_CBE 71.1040% 6 - C2 -4AEC 4.3 CYSKM_ARATH
122 HHSearch 70.9238% -8 - C2 -1Y7L 2.3 CYSK_HAEIN
119 HHSearch 70.8038% 17 - C2 -4LMB 4.1 ?
123 HHSearch 70.5840% 14 * C2 *1VE1 3.8 ?
62 PsiBlast_CBE 70.5839% 9 - C2 -3VBE 3.4 ?
58 PsiBlast_CBE 70.5339% 29 - C2 -3PC4 5.8 ?
53 PsiBlast_CBE 70.4040% 10 - C2 -2ECO 4.5 ?
76 PsiBlast_CBE 70.3339% -1 - C2 -1FCJ 3.7 CYSK_SALTY
59 PsiBlast_CBE 70.1339% 30 - C2 -3PC3 8.2 ?
77 PsiBlast_CBE 69.8439% -4 - C2 -1FCJ 3.4 CYSK_SALTY
61 PsiBlast_CBE 69.8039% 6 - C2 -3VBE 3.7 ?
60 PsiBlast_CBE 69.7139% 31 - C2 -3PC2 4.2 ?
75 PsiBlast_CBE 69.2639% -2 - C2 -1FCJ 2.9 CYSK_SALTY
71 PsiBlast_CBE 69.2438% -31 - C2 -4AIR 2.4 ?
31 PsiBlast_CBE 68.9438% 33 - C2 -4L0D 3.3 CBS_HUMAN
92 PsiBlast_CBE 68.9137% 28 - C2 -2PQM 3.6 ?
74 PsiBlast_CBE 68.8239% -4 - C2 -1FCJ 3.6 CYSK_SALTY
93 PsiBlast_CBE 68.6837% 24 - C2 -2PQM 3.9 ?
95 PsiBlast_CBE 68.2737% 23 - C2 -3BM5 4.3 ?
32 PsiBlast_CBE 68.0538% 35 - C2 -4COO 4.4 CBS_HUMAN
129 HHSearch 68.0135% 1 - C2 -2V03 3.4 CYSM_ECOLI
20 PsiBlast_PDB 67.9538% 26 - C2 -4PCU 3.2 CBS_HUMAN
16 PsiBlast_PDB 67.8238% 34 - C2 -4COO 4.3 CBS_HUMAN
94 PsiBlast_CBE 67.6437% 26 - C2 -3BM5 4.6 ?
15 PsiBlast_PDB 67.5738% 34 - C2 -4L0D 3.7 CBS_HUMAN
57 PsiBlast_CBE 67.3538% 22 - C2 -4LMB 4.1 ?
125 HHSearch 66.5737% 47 - C2 -2PQM 3.9 ?
41 PsiBlast_CBE 66.0938% 33 - C2 -4PCU 3.6 CBS_HUMAN
127 HHSearch 64.3336% 26 - C2 -3DWG 3.8 CYSM_MYCTU