@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu27330: (2016-07-12 )
MGKNPVVIGIAGGSGSGKTSVTRSIYEQFKGHSILMIQQDLYYKDQSHLPFEERLNTNYDHPLAFDNDYLIEHIQDLLNYRPIEKPIYDYKLHTRSEETVHVEPKDVIILEGILVLEDKRLRDLMDIKLYVDTDADLRIIRRIMRDINERGRSIDSVIEQYVSVVRPMHNQFVEPTKRYADIIIPEGGQNHVAIDLMVTKIQTILEQNAIL

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CTP_C_3(1UDW)
UCK2_HUMAN
[Raw transfer]




CTP_D_4(1UDW)
UCK2_HUMAN
[Raw transfer]




UTP_D_4(1UEI)
UCK2_HUMAN
[Raw transfer]




UTP_C_3(1UEI)
UCK2_HUMAN
[Raw transfer]




C5P_B_4(3ASZ)
URK_THET8
[Raw transfer]




C5P_A_3(3ASZ)
URK_THET8
[Raw transfer]




ACP_B_6(3W34)
URK_THET8
[Raw transfer]




ACP_A_4(3W34)
URK_THET8
[Raw transfer]




ACP_A_4(3W34)
URK_THET8
[Raw transfer]




CTN_D_4(1UEJ)
UCK2_HUMAN
[Raw transfer]




CTN_C_3(1UEJ)
UCK2_HUMAN
[Raw transfer]




ADP_B_8(1XRJ)
UCK2_HUMAN
[Raw transfer]




ADP_A_5(2UVQ)
UCK1_HUMAN
[Raw transfer]




ADP_A_5(2UVQ)
UCK1_HUMAN
[Raw transfer]




ADP_B_8(1UJ2)
UCK2_HUMAN
[Raw transfer]




CIT_F_6(1UEJ)
UCK2_HUMAN
[Raw transfer]




ADP_A_6(1UJ2)
UCK2_HUMAN
[Raw transfer]




ADP_A_6(1UJ2)
UCK2_HUMAN
[Raw transfer]




ADP_A_6(1XRJ)
UCK2_HUMAN
[Raw transfer]




ACP_B_6(3W8R)
URK_THET8
[Raw transfer]




ACP_A_4(3W8R)
URK_THET8
[Raw transfer]




CIT_E_5(1UEJ)
UCK2_HUMAN
[Raw transfer]




3 HHSearch 95.8652%-112 - C1 -3W34 3.4 URK_THET8
52 PsiBlast_CBE 89.2954%-105 - C1 -3W8R 3.3 URK_THET8
34 PsiBlast_PDB 88.2854%-107 - C1 -3ASZ 7.7 URK_THET8
35 PsiBlast_PDB 87.7454%-101 - C1 -3W34 3.4 URK_THET8
53 PsiBlast_CBE 87.4454%-109 - C1 -3W34 3.9 URK_THET8
33 PsiBlast_PDB 87.4254%-110 - C1 -3ASY - URK_THET8 -
32 PsiBlast_PDB 86.6754%-102 - C1 -3W8R 2.5 URK_THET8
54 PsiBlast_CBE 86.1354%-101 - C1 -3ASZ 6.6 URK_THET8
56 PsiBlast_CBE 74.8240% 6 * C1 *1UJ2 5.3 UCK2_HUMAN
40 PsiBlast_PDB 74.6440% 10 - C1 -1UFQ - UCK2_HUMAN -
36 PsiBlast_PDB 74.3540% 4 - C1 -1XRJ 5.7 UCK2_HUMAN
42 PsiBlast_PDB 73.9739% -12 - C1 -2JEO - UCK1_HUMAN -
41 PsiBlast_PDB 72.8940% 1 - C1 -1UJ2 6.0 UCK2_HUMAN
43 PsiBlast_PDB 72.6739% -16 - C1 -2UVQ 6.0 UCK1_HUMAN
2 HHSearch 71.9240% 25 - C1 -2JEO - UCK1_HUMAN -
55 PsiBlast_CBE 71.0240% 1 - C1 -1XRJ 6.4 UCK2_HUMAN
22 Fugue 69.7838% 28 - C1 -2JEO - UCK1_HUMAN -
1 HHSearch 69.6141% 30 - C1 -1UJ2 6.0 UCK2_HUMAN
37 PsiBlast_PDB 69.5240% -0 - C1 -1UDW 9.6 UCK2_HUMAN
58 PsiBlast_CBE 69.4340% 19 - C1 -1UEI 10.0 UCK2_HUMAN
39 PsiBlast_PDB 68.9140% 19 - C1 -1UEJ 6.9 UCK2_HUMAN
38 PsiBlast_PDB 68.7940% -6 - C1 -1UEI 9.7 UCK2_HUMAN
57 PsiBlast_CBE 67.3940% 26 - C1 -1UEJ 7.2 UCK2_HUMAN
23 Fugue 67.3039% 24 - C1 -2UVQ 6.0 UCK1_HUMAN
59 PsiBlast_CBE 66.5440% 24 - C1 -1UDW 10.2 UCK2_HUMAN