@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu27590: (2016-07-13 )
KRLVVQRVTEASVTVDEEVVGQIGQGLMVLVGITHDDTEDDAAYLADKVVNLRIFDDSEGKMNLSLVDIGGEILSVSQFTLYGDTKKGRRPNYMNAAKPDKALGLYEKWNDLLREKGIKVETGTFGAMMDVQLTNSGPVTLIMDSK

Atome Classification :

(37 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

D3Y_B_5(4NBI)
?
[Raw transfer]




D3Y_A_3(4NBI)
?
[Raw transfer]




D3Y_A_3(4NBI)
?
[Raw transfer]




EPE_A_9(3LMV)
?
[Raw transfer]




EPE_D_8(3LMV)
?
[Raw transfer]




EPE_C_10(3LMV)
?
[Raw transfer]




EPE_B_7(3LMV)
?
[Raw transfer]




DHI_C_8(3KOC)
?
[Raw transfer]




DSN_D_9(3KOD)
?
[Raw transfer]




ADP_C_9(3KO5)
?
[Raw transfer]




ADP_B_8(3KO5)
?
[Raw transfer]




ADP_B_7(3KO4)
?
[Raw transfer]




ADP_D_10(3KO5)
?
[Raw transfer]




DLY_C_7(3KO7)
?
[Raw transfer]




ADP_D_9(3KO4)
?
[Raw transfer]




DHI_D_7(3KOC)
?
[Raw transfer]




ADP_C_8(3KO4)
?
[Raw transfer]




ADP_C_7(3KO3)
?
[Raw transfer]




DSN_C_8(3KOD)
?
[Raw transfer]




81 HHSearch 93.1047%-131 - C10 -1J7G - DTD_HAEIN -
3 PsiBlast_PDB 90.9947%-131 - C10 -1J7G - DTD_HAEIN -
20 PsiBlast_CBE 90.8948%-131 - C10 -1JKE - DTD_ECOLI -
80 HHSearch 90.4355%-114 - C10 -2DBO - DTD_AQUAE -
1 PsiBlast_PDB 90.4055%-114 - C10 -2DBO - DTD_AQUAE -
70 Fugue 89.9746%-129 - C10 -1JKE - DTD_ECOLI -
79 HHSearch 89.9047%-133 - C10 -1JKE - DTD_ECOLI -
2 PsiBlast_PDB 89.3548%-136 - C10 -1JKE - DTD_ECOLI -
22 PsiBlast_CBE 86.9248%-117 - C10 -1JKE - DTD_ECOLI -
21 PsiBlast_CBE 86.7648%-118 - C10 -1JKE - DTD_ECOLI -
68 PsiBlast_CBE 83.0541% -75 - C10 -2OKV - DTD1_HUMAN -
83 HHSearch 82.3941% -65 - C10 -2OKV - DTD1_HUMAN -
19 PsiBlast_PDB 82.0541% -69 - C10 -2OKV - DTD1_HUMAN -
69 PsiBlast_CBE 80.7841% -70 - C10 -2OKV - DTD1_HUMAN -
67 PsiBlast_CBE 80.7041% -71 - C10 -2OKV - DTD1_HUMAN -
32 PsiBlast_CBE 76.3436% 7 - C10 -3LMV 2.1 ?
6 PsiBlast_PDB 75.4436% -3 - C10 -3KO5 - ? -
42 PsiBlast_CBE 74.7736% 4 - C10 -3LMT - ? -
53 PsiBlast_CBE 74.4236% 20 - C10 -3KO9 - ? -
31 PsiBlast_CBE 74.3036% 8 - C10 -3LMV - ? -
50 PsiBlast_CBE 73.8736% 21 - C10 -3KOC 3.2 ?
34 PsiBlast_CBE 73.8336% 2 - C10 -3LMV 3.1 ?
58 PsiBlast_CBE 73.6336% 6 - C10 -3KO5 3.2 ?
16 PsiBlast_PDB 73.5036% 28 - C10 -3LMV 2.5 ?
57 PsiBlast_CBE 73.3836% -3 - C10 -3KO5 3.1 ?
65 PsiBlast_CBE 73.3136% -0 - C10 -3KO3 2.8 ?
33 PsiBlast_CBE 73.3136% -1 - C10 -3LMV 2.1 ?
63 PsiBlast_CBE 72.8036% 19 - C10 -3KO4 3.2 ?
56 PsiBlast_CBE 72.6136% 21 - C10 -3KO5 3.0 ?
54 PsiBlast_CBE 72.6036% 29 - C10 -3KO7 1.8 ?
61 PsiBlast_CBE 71.4736% 23 - C10 -3KO4 3.4 ?
30 PsiBlast_CBE 71.4636% 28 - C10 -4NBI 8.6 ?
62 PsiBlast_CBE 71.2136% 5 - C10 -3KO4 3.9 ?
82 HHSearch 70.9939% 51 * C10 *4NBI 8.2 ?
17 PsiBlast_PDB 70.0136% 54 - C10 -4NBI 8.2 ?
47 PsiBlast_CBE 69.9636% 5 - C10 -3KOD 2.9 ?
51 PsiBlast_CBE 68.9636% 52 - C10 -3KOC 4.2 ?