Study : bsu28050 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C4_S1
Best Complexes choosen after comparative docking [pKd > 3] : 4 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C4_S1
Complex: GOL_A_3(4JHC) / Model_27(4JHC/A) = [3.5] Download484.1820.17MTKPLILASQSPRRKELLDLLQLPYSIIVSEVEEKLNRNFSPEENVQWLAKQKAKAVADLHPHAIVIGADTMVCLDGECLGKPQDQEEAASMLRRLSGRSHSVITAVSIQAENHSETFYDKTEVAFWSLSEEEIWTYIETKEPMDKAGAYGIQGRGALFVKKIDGDYYSVMGLPISKTMRALRHFDIRA
Complex: GOL_A_3(4JHC) / Model_7(4JHC/A) = [3.5] Download291.2820.17MTKPLILASQSPRRKELLDLLQLPYSIIVSEVEEKLNRNFSPEENVQWLAKQKAKAVADLHPHAIVIGADTMVCLDGECLGKPQDQEEAASMLRRLSGRSHSVITAVSIQAENHSETFYDKTEVAFWSLSEEEIWTYIETKEPMDKAGAYGIQGRGALFVKKIDGDYYSVMGLPISKTMRALRHFDIRA
Complex: DUT_A_4(1EXC) / Model_2(1EXC/A) = [4.0] Download1024.9712.50MTKPLILASQSPRRKELLDLLQLPYSIIVSEVEEKLNRNFSPEENVQWLAKQKAKAVADLHPHAIVIGADTMVCLDGECLGKPQDQEEAASMLRRLSGRSHSVITAVSIQAENHSETFYDKTEVAFWSLSEEEIWTYIETKEPMDKAGAYGIQGRGALFVKKIDGDYYSVMGLPISKTMRALRHFDIRA
Complex: DUT_B_5(1EXC) / Model_17(1EXC/B) = [4.7] Download1498.678.35MTKPLILASQSPRRKELLDLLQLPYSIIVSEVEEKLNRNFSPEENVQWLAKQKAKAVADLHPHAIVIGADTMVCLDGECLGKPQDQEEAASMLRRLSGRSHSVITAVSIQAENHSETFYDKTEVAFWSLSEEEIWTYIETKEPMDKAGAYGIQGRGALFVKKIDGDYYSVMGLPISKTMRALRHFDIRA
Consensus
[pKd Mean = 3.92]
-824
(s=472)
15
(s=5)
MTKPLILASQSPRRKELLDLLQLPYSIIVSEVEEKLNRNFSPEENVQWLAKQKAKAVADLHPHAIVIGADTMVCLDGECLGKPQDQEEAASMLRRLSGRSHSVITAVSIQAENHSETFYDKTEVAFWSLSEEEIWTYIETKEPMDKAGAYGIQGRGALFVKKIDGDYYSVMGLPISKTMRALRHFDIRA