@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu28130: (2016-07-14 )
MSQSFNRHRRLRTSKAMREMVKETRLHPSDFIYPIFVVEGLEGKKAVPSMPDVHHVSLDLLKDEVAELVKLGIQSVIVFGIPEEKDDCGTQAYHDHGIVQKAITEIKEHFPEMVVVADTCLCEYTDHGHCGLVKDGVILNDESLELLAQTAVSQAKAGADIIAPSNMMDGFVTVIREALDKEGFVNIPIMSYAVKYSSEFYGPFRDAANSTPQFGDRKTYQMDPANRMEALREAQSDVEEGADFLIVKPSLSYMDIMRDVKNEFTLPLVAYNVSGEYSMVKAAAQNGWIKEKEIVLEILTSMKRAGADLIITYHAKDAAKWLAE

Atome Classification :

(38 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PBG_A_2(5IC2)
?
[Raw transfer]




PBG_A_4(1OHL)
HEM2_YEAST
[Raw transfer]




PBG_A_3(1E51)
HEM2_HUMAN
[Raw transfer]




FMT_A_3(1W56)
HEM2_PSEAE
[Raw transfer]




FMT_B_7(1W56)
HEM2_PSEAE
[Raw transfer]




FMT_B_9(1W5Q)
HEM2_PSEAE
[Raw transfer]




FMT_B_10(1W5M)
HEM2_PSEAE
[Raw transfer]




FMT_A_5(1W5M)
HEM2_PSEAE
[Raw transfer]




FMT_A_3(1W5N)
HEM2_PSEAE
[Raw transfer]




4OX_A_2(1GJP)
HEM2_YEAST
[Raw transfer]




FMT_B_8(1W5N)
HEM2_PSEAE
[Raw transfer]




DSB_B_8(1I8J)
HEM2_ECOLI
[Raw transfer]




PB1_A_5(1PV8)
HEM2_HUMAN
[Raw transfer]




GOL_A_8(5IC2)
?
[Raw transfer]




DSB_A_7(1L6S)
HEM2_ECOLI
[Raw transfer]




4OX_A_7(1L6Y)
HEM2_ECOLI
[Raw transfer]




DSB_A_7(1L6S)
HEM2_ECOLI
[Raw transfer]




AYC_A_2(2WOQ)
HEM2_PSEAE
[Raw transfer]




SHF_A_5(1B4K)
HEM2_PSEAE
[Raw transfer]




SHF_A_5(1B4K)
HEM2_PSEAE
[Raw transfer]




DSB_A_7(1I8J)
HEM2_ECOLI
[Raw transfer]




SHF_A_2(1H7N)
HEM2_YEAST
[Raw transfer]




SHF_A_2(1H7N)
HEM2_YEAST
[Raw transfer]




KAH_A_2(1H7P)
HEM2_YEAST
[Raw transfer]




SHF_A_8(1B4E)
HEM2_ECOLI
[Raw transfer]




SHU_A_2(1H7R)
HEM2_YEAST
[Raw transfer]




DAV_A_5(5HNR)
HEM2_HUMAN
[Raw transfer]




DSB_B_6(2C1H)
HEM2_CHLP8
[Raw transfer]




SHF_A_3(1YLV)
HEM2_YEAST
[Raw transfer]




SHF_A_3(1W1Z)
HEM2_CHLP8
[Raw transfer]




SHF_A_3(1W1Z)
HEM2_CHLP8
[Raw transfer]




DSB_A_2(1EB3)
HEM2_YEAST
[Raw transfer]




SHF_B_5(1W1Z)
HEM2_CHLP8
[Raw transfer]




DAV_A_2(1H7O)
HEM2_YEAST
[Raw transfer]




SHO_A_2(1W31)
HEM2_YEAST
[Raw transfer]




DSB_A_4(2C1H)
HEM2_CHLP8
[Raw transfer]




10 PsiBlast_PDB 82.8749%-110 - C8 -1L6Y 4.5 HEM2_ECOLI
8 PsiBlast_PDB 82.7249%-106 - C8 -5IC2 6.8 ?
28 PsiBlast_CBE 82.6649%-104 - C8 -1I8J 3.1 HEM2_ECOLI
60 HHSearch 82.4549%-105 - C8 -1L6S 2.4 HEM2_ECOLI
9 PsiBlast_PDB 82.0849%-106 - C8 -1L6S 2.4 HEM2_ECOLI
11 PsiBlast_PDB 82.0149%-104 - C8 -1I8J 2.9 HEM2_ECOLI
7 PsiBlast_PDB 81.8449%-106 - C8 -1B4E 3.7 HEM2_ECOLI
59 HHSearch 81.4351%-117 * C8 *1W1Z 2.5 HEM2_CHLP8
22 PsiBlast_CBE 80.6751%-118 - C8 -1W1Z 3.6 HEM2_CHLP8
21 PsiBlast_CBE 80.0151%-119 - C8 -2C1H 1.5 HEM2_CHLP8
2 PsiBlast_PDB 79.7351%-118 - C8 -2C1H 3.1 HEM2_CHLP8
1 PsiBlast_PDB 79.5251%-119 - C8 -1W1Z 2.5 HEM2_CHLP8
61 HHSearch 72.0046% -11 - C8 -3OBK - ? -
5 PsiBlast_PDB 71.9446% -23 - C8 -1W56 3.6 HEM2_PSEAE
3 PsiBlast_PDB 71.8247% -24 - C8 -1W5O - HEM2_PSEAE -
4 PsiBlast_PDB 71.6946% -25 - C8 -1W5N 3.6 HEM2_PSEAE
34 PsiBlast_CBE 71.6646% -20 - C8 -3OBK - ? -
42 PsiBlast_CBE 71.6544% -29 - C8 -1W31 3.5 HEM2_YEAST
41 PsiBlast_CBE 71.6344% -30 - C8 -1H7O 3.3 HEM2_YEAST
40 PsiBlast_CBE 71.6044% -32 - C8 -1EB3 3.0 HEM2_YEAST
47 PsiBlast_CBE 71.5844% -30 - C8 -1H7P 3.0 HEM2_YEAST
25 PsiBlast_CBE 71.2446% -24 - C8 -1W5N 3.7 HEM2_PSEAE
6 PsiBlast_PDB 71.1546% -18 - C8 -1W5M 3.5 HEM2_PSEAE
45 PsiBlast_CBE 71.1044% -31 - C8 -1OHL 3.7 HEM2_YEAST
63 HHSearch 71.0642% -29 - C8 -1H7N 3.7 HEM2_YEAST
38 PsiBlast_CBE 70.9844% -30 - C8 -1YLV 3.4 HEM2_YEAST
14 PsiBlast_PDB 70.9246% -10 - C8 -2WOQ 3.4 HEM2_PSEAE
26 PsiBlast_CBE 70.7646% -22 - C8 -1W5M 3.5 HEM2_PSEAE
48 PsiBlast_CBE 70.7344% -28 - C8 -1H7N 3.7 HEM2_YEAST
46 PsiBlast_CBE 70.7344% -30 - C8 -1H7R 3.0 HEM2_YEAST
39 PsiBlast_CBE 70.6844% -30 - C8 -1GJP 2.3 HEM2_YEAST
49 Fugue 70.5146% -8 - C8 -1B4K 3.7 HEM2_PSEAE
13 PsiBlast_PDB 70.4446% -13 - C8 -1B4K 3.7 HEM2_PSEAE
27 PsiBlast_CBE 70.2746% -22 - C8 -1W56 3.9 HEM2_PSEAE
23 PsiBlast_CBE 69.8847% -26 - C8 -1W5Q 3.6 HEM2_PSEAE
18 PsiBlast_PDB 68.1644% -39 - C8 -1E51 4.0 HEM2_HUMAN
20 PsiBlast_PDB 68.1144% -40 - C8 -5HNR 3.0 HEM2_HUMAN
17 PsiBlast_PDB 66.9844%-100 - C8 -1PV8 1.9 HEM2_HUMAN