@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu28500: (2016-07-15 )
MAIVKATDQSFSAETSEGVVLADFWAPWCGPCKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHL

Atome Classification :

(49 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_D_9(5E4W)
?
[Raw transfer]




EDO_C_11(3TCO)
?
[Raw transfer]




GOL_B_5(4AJ6)
?
[Raw transfer]




GTP_A_10(2BTO)
THIO_ECOLI
[Raw transfer]




MPD_A_5(2TRX)
THIO_ECOLI
[Raw transfer]




MPD_B_5(2EIQ)
THIO_ECOLI
[Raw transfer]




GOL_B_9(4AJ8)
?
[Raw transfer]




PX5_C_7(3O6T)
THIO_MYCTU
[Raw transfer]




PX5_A_5(3O6T)
THIO_MYCTU
[Raw transfer]




EDO_A_3(4POB)
?
[Raw transfer]




MPD_B_6(2TRX)
THIO_ECOLI
[Raw transfer]




BME_A_2(2I4A)
?
[Raw transfer]




MPD_A_3(2H76)
THIO_ECOLI
[Raw transfer]




MPD_D_13(2FCH)
THIO_ECOLI
[Raw transfer]




MPD_B_5(2H6Z)
THIO_ECOLI
[Raw transfer]




MPD_A_14(2FCH)
THIO_ECOLI
[Raw transfer]




MPD_B_8(2TRX)
THIO_ECOLI
[Raw transfer]




MPD_B_5(2H72)
THIO_ECOLI
[Raw transfer]




MPD_G_11(2FCH)
THIO_ECOLI
[Raw transfer]




MPD_A_10(2TRX)
THIO_ECOLI
[Raw transfer]




MPD_B_4(2H75)
THIO_ECOLI
[Raw transfer]




DTU_A_3(3ZZX)
?
[Raw transfer]




MPD_A_3(2H6Z)
THIO_ECOLI
[Raw transfer]




MPD_A_3(2H73)
THIO_ECOLI
[Raw transfer]




MPD_A_3(2H74)
THIO_ECOLI
[Raw transfer]




MPD_A_3(2H6X)
THIO_ECOLI
[Raw transfer]




MPD_A_3(2H70)
THIO_ECOLI
[Raw transfer]




MPD_B_5(2H70)
THIO_ECOLI
[Raw transfer]




MPD_E_9(2FCH)
THIO_ECOLI
[Raw transfer]




MPD_A_3(2H71)
THIO_ECOLI
[Raw transfer]




MPD_A_3(2H6Y)
THIO_ECOLI
[Raw transfer]




MPD_A_9(2TRX)
THIO_ECOLI
[Raw transfer]




MPD_A_3(2H72)
THIO_ECOLI
[Raw transfer]




24 PsiBlast_PDB 84.4799%-132 - C1 -2VOC - THIO_BACSU -
22 PsiBlast_PDB 83.21100%-129 - C1 -2GZY - THIO_BACSU -
11 HHSearch 83.1899%-128 - C1 -2VOC - THIO_BACSU -
23 PsiBlast_PDB 82.19100%-137 - C1 -2GZZ - THIO_BACSU -
25 PsiBlast_PDB 79.1299%-129 - C1 -2IPA - THIO_BACSU -
31 PsiBlast_PDB 71.6460%-131 - C1 -2O89 - THIO_STAAU -
28 PsiBlast_PDB 70.2761%-143 - C1 -2O85 - THIO_STAAU -
30 PsiBlast_PDB 69.6061%-148 - C1 -2O87 - THIO_STAAU -
113 PsiBlast_CBE 69.4939%-182 - C1 -1XWB - THIO2_DROME -
115 PsiBlast_CBE 68.1239%-182 - C1 -1XWB - THIO2_DROME -
111 PsiBlast_CBE 67.3037%-187 - C1 -3TCO Error ?
114 PsiBlast_CBE 67.0939%-186 - C1 -1XWB - THIO2_DROME -
110 PsiBlast_CBE 66.2837%-189 - C1 -3TCO - ? -
27 PsiBlast_PDB 65.4962%-141 - C- -2O7K - THIO_STAAU -
109 PsiBlast_CBE 65.4539%-177 - C1 -1XWA - THIO2_DROME -
119 PsiBlast_CBE 63.6943%-163 - C1 -4V2M - ? -
124 PsiBlast_CBE 63.5743%-172 - C1 -4AJ7 - ? -
126 PsiBlast_CBE 63.4843%-159 - C1 -4AJ6 Error ?
121 PsiBlast_CBE 63.4443%-165 - C1 -4V2L - ? -
120 PsiBlast_CBE 63.1443%-174 - C1 -4V2L - ? -
128 PsiBlast_CBE 62.6243%-159 - C1 -3ZZX 2.6 ?
40 PsiBlast_PDB 59.1649% 25 - C1 -2H73 2.6 THIO_ECOLI
57 PsiBlast_CBE 58.3648% 11 - C1 -2TRX 4.2 THIO_ECOLI
95 PsiBlast_CBE 58.1452% 11 - C1 -4POB 2.8 ?
77 PsiBlast_CBE 58.0747% 18 - C1 -2EIQ Error THIO_ECOLI
100 PsiBlast_CBE 56.8152% 4 - C1 -3O6T 4.6 THIO_MYCTU
65 PsiBlast_CBE 55.9148% 27 - C1 -2H74 2.4 THIO_ECOLI
98 PsiBlast_CBE 55.8652% 5 - C1 -3O6T 4.5 THIO_MYCTU
70 PsiBlast_CBE 54.8147% 30 - C1 -2H6Z 2.7 THIO_ECOLI
50 PsiBlast_CBE 54.7949% 14 - C1 -2FCH 2.9 THIO_ECOLI
68 PsiBlast_CBE 54.7447% 20 - C1 -2H72 2.7 THIO_ECOLI
64 PsiBlast_CBE 54.7148% 12 - C1 -5E4W Error ?
122 PsiBlast_CBE 54.6443%-152 - C1 -4AJ8 Error ?
49 PsiBlast_CBE 54.1349% 23 - C1 -2FCH 2.7 THIO_ECOLI
74 PsiBlast_CBE 53.8647% 32 - C1 -2H70 2.6 THIO_ECOLI
39 PsiBlast_PDB 53.0949% 18 - C1 -2FCH 2.7 THIO_ECOLI
71 PsiBlast_CBE 52.9347% 36 - C1 -2H6Z 2.8 THIO_ECOLI
41 PsiBlast_PDB 52.7148% 27 - C1 -2H71 2.8 THIO_ECOLI
106 PsiBlast_CBE 52.6345% 28 - C1 -2I4A 2.8 ?
69 PsiBlast_CBE 52.6147% 23 - C1 -2H72 3.5 THIO_ECOLI
59 PsiBlast_CBE 52.5348% 29 - C1 -2H6X 3.6 THIO_ECOLI
60 PsiBlast_CBE 52.1648% 10 - C1 -2BTO Error THIO_ECOLI
66 PsiBlast_CBE 52.0448% 31 - C1 -2H75 2.7 THIO_ECOLI
72 PsiBlast_CBE 51.0547% 32 - C1 -2H6Y 2.5 THIO_ECOLI
53 PsiBlast_CBE 50.8048% 29 - C1 -2H76 3.9 THIO_ECOLI
75 PsiBlast_CBE 49.7547% 28 - C1 -2H70 2.5 THIO_ECOLI
48 PsiBlast_CBE 49.5949% 19 - C1 -2FCH 2.8 THIO_ECOLI
58 PsiBlast_CBE 48.6948% 20 - C1 -2TRX 3.4 THIO_ECOLI
132 Fugue 43.6350% 61 * C1 *2TRX 3.7 THIO_ECOLI