@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu28810: (2016-07-16 )
MKKKKTWKRFLHFSSAALAAGLIFTSAAPAEAAFWGASNELLHDPTMIKEGSSWYALGTGLTEERGLRVLKSSDAKNWTVQKSIFTTPLSWWSNYVPNYGQNQWAPDIQYYNGKYWLYYSVSSFGSNTSAIGLASSTSISSGGWKDEGLVIRSTSSNNYNAIDPELTFDKDGNPWLAFGSFWSGIKLTKLDKSTMKPTGSLYSIAARPNNGGALEAPTLTYQNGYYYLMVSFDKCCDGVNSTYKIAYGRSKSITGPYLDKSGKSMLEGGGTILDSGNDQWKGPGGQDIVNGNILVRHAYDANDNGIPKLLINDLNWSSGWPSY

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_3(3CU9)
IABN_GEOSE
[Raw transfer]




GOL_A_3(3CU9)
IABN_GEOSE
[Raw transfer]




SUGAR_A_2(3D5Z)
IABN_GEOSE
[Raw transfer]

-

SUGAR_A_2(3D61)
IABN_GEOSE
[Raw transfer]

-

SUGAR_B_2(1GYE)
ARBA_CELJU
[Raw transfer]

-

MPD_A_12(2X8F)
EABN2_BACSU
[Raw transfer]




1 PsiBlast_PDB 97.27100% -47 - C1 -1UV4 - EABN1_BACSU -
31 HHSearch 87.24100% 3 - C1 -1UV4 - EABN1_BACSU -
4 PsiBlast_PDB 74.1252% -4 - C1 -3D5Y - IABN_GEOSE -
3 PsiBlast_PDB 73.5853% -1 - C1 -3CU9 2.6 IABN_GEOSE
2 PsiBlast_PDB 73.2553% -1 - C1 -1WL7 - IABN_GEOTD -
6 PsiBlast_PDB 72.6352% 2 - C1 -3D60 - IABN_GEOSE -
5 PsiBlast_PDB 72.4252% 1 - C1 -3D5Z 5.7 IABN_GEOSE
7 PsiBlast_PDB 72.1052% 4 - C1 -3D61 4.3 IABN_GEOSE
32 HHSearch 70.0552% 8 - C1 -3CU9 2.6 IABN_GEOSE
8 PsiBlast_PDB 69.2238% -2 - C1 -4KCB - ? -
24 PsiBlast_CBE 68.4438% -2 - C1 -1GYH - ARBA_CELJU -
23 PsiBlast_CBE 68.3238% 1 - C1 -1GYH - ARBA_CELJU -
10 PsiBlast_PDB 68.1638% -2 - C1 -1GYH - ARBA_CELJU -
9 PsiBlast_PDB 67.8939% 0 - C1 -1GYD - ARBA_CELJU -
26 PsiBlast_CBE 67.5938% 0 - C1 -1GYH - ARBA_CELJU -
21 PsiBlast_CBE 67.3338% 5 - C1 -4KCB - ? -
22 PsiBlast_CBE 67.1138% -1 * C1 *1GYH - ARBA_CELJU -
51 Fugue 67.1040% -3 - C1 -1GYH - ARBA_CELJU -
25 PsiBlast_CBE 66.7838% 1 - C1 -1GYH - ARBA_CELJU -
34 HHSearch 66.7542% 1 - C1 -4KCB - ? -
11 PsiBlast_PDB 66.4038% 1 - C1 -1GYE 7.3 ARBA_CELJU