@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu28980: (2016-07-16 )
MEPIGRSLQGVTGRPDFQKRLEQMKEKVMKDQDVQAFLKENEEVIDQKMIEKSLNKLYEYIEQSKNCSYCSEDENCNNLLEGYHPKLVVNGRSIDIEYYECPVKRKLDQQKKQQSLMKSMYIQQDLLGATFQQVDISDPSRLAMFQHVTDFLKSYNETGKGKGLYLYGKFGVGKTFMLAAIANELAEKEYSSMIVYVPEFVRELKNSLQDQTLEEKLNMVKTTPVLMLDDIGAESMTSWVRDEVIGTVLQHRMSQQLPTFFSSNFSPDELKHHFTYSQRGEKEEVKAARLMERILYLAAPIRLDGENRRHP

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_3(2W58)
?
[Raw transfer]




ADP_A_3(2W58)
?
[Raw transfer]




1 PsiBlast_PDB 72.26100% -98 - C5 -4M4W - DNAI_BACSU -
112 HHSearch 67.0699% 10 - C5 -4M4W - DNAI_BACSU -
2 PsiBlast_PDB 64.2758%-143 - C5 -2W58 5.7 ?
114 HHSearch 61.5658%-106 - C5 -2W58 5.7 ?
133 Fugue 56.8937%-142 - C5 -2QGZ - ? -
113 HHSearch 54.9234% -67 * C5 *2QGZ - ? -
132 Fugue 52.09100% -93 - C8 -2K7R - DNAI_BACSU -
3 PsiBlast_PDB 51.86100% -93 * C8 *2K7R - DNAI_BACSU -
120 HHSearch 48.0922%-142 - C5 -1L8Q - DNAA_AQUAE -
118 HHSearch 47.8324%-157 - C5 -5BQ5 - ISTB_GEOSE -
4 PsiBlast_PDB 45.4634% 45 - C5 -2QGZ - ? -
117 HHSearch 45.4421% -48 - C5 -3EC2 - ? -
15 PsiBlast_PDB 42.0035%-232 - C4 -1SXJ - RFC3_YEAST -
5 PsiBlast_PDB 40.7628% -50 - C7 -3ECC - ? -
9 PsiBlast_PDB 38.7630%-148 - C7 -1L8Q - DNAA_AQUAE -
6 PsiBlast_PDB 38.0730% -12 - C7 -3EC2 - ? -
8 PsiBlast_PDB 37.8132%-150 - C7 -2HCB - DNAA_AQUAE -
23 PsiBlast_CBE 36.8832%-143 - C7 -3R8F - DNAA_AQUAE -
22 PsiBlast_CBE 36.8232%-143 - C7 -3R8F - DNAA_AQUAE -
7 PsiBlast_PDB 36.4832%-143 - C7 -3R8F - DNAA_AQUAE -