@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu29050: (2016-07-16 )
MTTHLQAKATLHNGVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNEAGVGEGIREGIEEAGISREDLFITSKVWNADLGYEETLAAFETSLSKLGLDYLDLYLIHWPVEGKYKEAWRALETLYKEGRIKAIGVSNFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYCQNQGIQMEAWSPLMQGQLLDHPVLADIAQTYNKSVAQIILRWDLQHGIITIPKSTKEHRIKENASVFDFELTQDDMNRIDALNENLRVGPDPDNFDF

Atome Classification :

(91 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NDP_B_6(3WBW)
?
[Raw transfer]




NAP_A_3(4GIE)
PGFS_TRYCC
[Raw transfer]




NAP_B_4(1VP5)
?
[Raw transfer]




NAP_A_3(4GIE)
PGFS_TRYCC
[Raw transfer]




NDP_A_4(3WBW)
?
[Raw transfer]




NAP_A_3(1VP5)
?
[Raw transfer]




NDP_A_3(4G5D)
PGFS_LEIMA
[Raw transfer]




NAP_B_6(3UZX)
AK1D1_HUMAN
[Raw transfer]




NAP_B_4(3G1R)
AK1D1_HUMAN
[Raw transfer]




NAP_A_5(3FX4)
AK1A1_PIG
[Raw transfer]




NAP_A_2(4GAB)
AK1BA_HUMAN
[Raw transfer]




NAP_A_2(3H7U)
AKRC9_ARATH
[Raw transfer]




NAP_A_3(3H4G)
AK1A1_PIG
[Raw transfer]




NAP_A_3(3UZX)
AK1D1_HUMAN
[Raw transfer]




NAP_A_2(3H7U)
AKRC9_ARATH
[Raw transfer]




NDP_A_5(2VDG)
ALDR_HORVU
[Raw transfer]




NAP_A_2(3H7R)
AKRC8_ARATH
[Raw transfer]




NAP_A_3(3UZW)
AK1D1_HUMAN
[Raw transfer]




NDP_B_4(3D3F)
GR_BACSU
[Raw transfer]




NAP_A_3(3COT)
AK1D1_HUMAN
[Raw transfer]




NAP_B_6(3UZZ)
AK1D1_HUMAN
[Raw transfer]




NAP_B_9(3CAS)
AK1D1_HUMAN
[Raw transfer]




NAP_A_4(3BUV)
AK1D1_HUMAN
[Raw transfer]




NAP_A_6(3CV7)
AK1A1_PIG
[Raw transfer]




NAP_B_6(3UZY)
AK1D1_HUMAN
[Raw transfer]




NAP_B_4(3DOP)
AK1D1_HUMAN
[Raw transfer]




NAP_B_3(3BUV)
AK1D1_HUMAN
[Raw transfer]




NAP_A_3(3G1R)
AK1D1_HUMAN
[Raw transfer]




NAP_A_3(3BUR)
AK1D1_HUMAN
[Raw transfer]




NAP_A_2(4GA8)
AK1BA_HUMAN
[Raw transfer]




NDP_B_4(4G5D)
PGFS_LEIMA
[Raw transfer]




NDP_A_2(2BGS)
ALDR_HORVU
[Raw transfer]




NAP_A_3(3CAV)
AK1D1_HUMAN
[Raw transfer]




NDP_A_3(3D3F)
GR_BACSU
[Raw transfer]




NAP_A_3(3CMF)
AK1D1_HUMAN
[Raw transfer]




NAP_A_3(3CAS)
AK1D1_HUMAN
[Raw transfer]




NAP_B_5(3CMF)
AK1D1_HUMAN
[Raw transfer]




NAP_A_3(3BV7)
AK1D1_HUMAN
[Raw transfer]




NAP_X_2(1ZUA)
AK1BA_HUMAN
[Raw transfer]




NAP_A_3(3DOP)
AK1D1_HUMAN
[Raw transfer]




NAP_B_2(1A80)
DKGA_CORSC
[Raw transfer]




NAP_A_3(3UZY)
AK1D1_HUMAN
[Raw transfer]




NAP_B_5(3BUR)
AK1D1_HUMAN
[Raw transfer]




NAP_B_5(3UZW)
AK1D1_HUMAN
[Raw transfer]




NDP_A_3(3CAQ)
AK1D1_HUMAN
[Raw transfer]




NAP_A_2(3GUG)
AK1C1_HUMAN
[Raw transfer]




NAP_C_3(1VBJ)
PGFS_TRYBB
[Raw transfer]




NAP_C_3(1VBJ)
PGFS_TRYBB
[Raw transfer]




NAP_D_4(1VBJ)
PGFS_TRYBB
[Raw transfer]




NAP_A_2(3NTY)
AK1C1_HUMAN
[Raw transfer]




NAP_A_2(1MRQ)
AK1C1_HUMAN
[Raw transfer]




NAP_A_3(3UZZ)
AK1D1_HUMAN
[Raw transfer]




NAP_B_9(3CAV)
AK1D1_HUMAN
[Raw transfer]




NAP_B_5(3COT)
AK1D1_HUMAN
[Raw transfer]




NAP_A_3(4GQ0)
AK1BA_HUMAN
[Raw transfer]




NAP_A_2(4GQG)
AK1BA_HUMAN
[Raw transfer]




NAP_B_4(3BV7)
AK1D1_HUMAN
[Raw transfer]




NDP_B_8(3CAQ)
AK1D1_HUMAN
[Raw transfer]




GLU_A_3(4FZI)
PGFS_TRYCC
[Raw transfer]




EDO_A_10(4F40)
PGFS_LEIMA
[Raw transfer]




GLU_B_4(4FZI)
PGFS_TRYCC
[Raw transfer]




EDO_B_20(4F40)
PGFS_LEIMA
[Raw transfer]




GOL_B_8(3O0K)
?
[Raw transfer]




NAP_A_3(4YVP)
AK1C1_HUMAN
[Raw transfer]




GOL_D_12(3O0K)
?
[Raw transfer]




GOL_C_10(3O0K)
?
[Raw transfer]




NAP_A_3(4JIH)
AK1BA_HUMAN
[Raw transfer]




NAP_A_3(4I5X)
AK1BA_HUMAN
[Raw transfer]




NAP_X_2(4JII)
AK1BA_HUMAN
[Raw transfer]




NAP_B_5(4YVP)
AK1C1_HUMAN
[Raw transfer]




GOL_I_9(1MZR)
DKGA_ECOLI
[Raw transfer]




CIT_E_5(1VBJ)
PGFS_TRYBB
[Raw transfer]




NAP_A_2(3WCZ)
AK2E4_BOMMO
[Raw transfer]




NDP_B_4(3WBY)
?
[Raw transfer]




NDP_A_3(3WBY)
?
[Raw transfer]




CIT_F_6(1VBJ)
PGFS_TRYBB
[Raw transfer]




NAP_A_2(1AH3)
ALDR_PIG
[Raw transfer]




GOL_C_10(3O0K)
?
[Raw transfer]




GOL_D_12(3O0K)
?
[Raw transfer]




GOL_D_12(3O0K)
?
[Raw transfer]




NAP_A_2(1AH4)
ALDR_PIG
[Raw transfer]




C2U_A_7(3CV7)
AK1A1_PIG
[Raw transfer]




NAP_A_2(1AH0)
ALDR_PIG
[Raw transfer]




FX4_A_6(3FX4)
AK1A1_PIG
[Raw transfer]




1BO_A_6(2VDG)
ALDR_HORVU
[Raw transfer]




EDO_A_12(4F40)
PGFS_LEIMA
[Raw transfer]




EDO_A_12(4F40)
PGFS_LEIMA
[Raw transfer]




FLC_A_4(4GAC)
AK1A1_MOUSE
[Raw transfer]




NAP_B_2(1CWN)
AK1A1_PIG
[Raw transfer]




NAP_B_2(1AE4)
AK1A1_PIG
[Raw transfer]




22 PsiBlast_CBE 98.12100% -96 - C5 -3B3D - YTBE_BACSU -
21 PsiBlast_CBE 97.45100% -90 - C5 -3B3D - YTBE_BACSU -
101 HHSearch 96.33100% -89 - C5 -3B3D - YTBE_BACSU -
1 PsiBlast_PDB 96.33100% -89 - C5 -3B3D - YTBE_BACSU -
104 HHSearch 86.0672% -78 - C5 -3F7J - GR_BACSU -
2 PsiBlast_PDB 85.8571% -78 - C5 -3F7J - GR_BACSU -
24 PsiBlast_CBE 85.6571% -84 - C5 -3D3F 11.0 GR_BACSU
3 PsiBlast_PDB 85.3271% -78 - C5 -3D3F 12.3 GR_BACSU
23 PsiBlast_CBE 85.2871% -79 - C5 -3F7J - GR_BACSU -
27 PsiBlast_CBE 84.3955% -92 - C5 -4FZI 2.4 PGFS_TRYCC
102 HHSearch 81.0451% -96 - C5 -1VBJ 11.2 PGFS_TRYBB
8 PsiBlast_PDB 80.4851% -96 - C5 -1VBJ 11.2 PGFS_TRYBB
28 PsiBlast_CBE 79.7251% -92 - C5 -1VBJ 9.7 PGFS_TRYBB
105 HHSearch 79.6356% -58 - C5 -4GIE 12.9 PGFS_TRYCC
7 PsiBlast_PDB 79.3155% -56 - C5 -4GIE 12.9 PGFS_TRYCC
6 PsiBlast_PDB 78.8055% -58 - C5 -4FZI 2.5 PGFS_TRYCC
26 PsiBlast_CBE 73.5356% -20 - C5 -4F40 2.6 PGFS_LEIMA
25 PsiBlast_CBE 73.5056% -11 - C5 -4G5D 12.8 PGFS_LEIMA
115 HHSearch 73.4447% -59 - C5 -4MHB - ? -
4 PsiBlast_PDB 73.3956% -20 - C5 -4F40 2.4 PGFS_LEIMA
106 HHSearch 73.3458% -22 - C5 -4F40 2.4 PGFS_LEIMA
5 PsiBlast_PDB 72.6956% -12 - C5 -4G5D 12.4 PGFS_LEIMA
16 PsiBlast_PDB 68.7741% -18 - C5 -3H4G 1.9 AK1A1_PIG
117 HHSearch 68.7240% -36 - C5 -3H7U Error AKRC9_ARATH
17 PsiBlast_PDB 68.6041% -16 - C5 -3FX4 4.0 AK1A1_PIG
54 PsiBlast_CBE 68.2541% -34 - C5 -4GAB 3.7 AK1BA_HUMAN
55 PsiBlast_CBE 68.1941% -36 - C5 -4GA8 3.1 AK1BA_HUMAN
49 PsiBlast_CBE 68.0740% -35 - C5 -4JII 2.5 AK1BA_HUMAN
29 PsiBlast_CBE 67.9952% -15 - C5 -1VP5 12.4 ?
12 PsiBlast_PDB 67.9647% -20 - C5 -1MZR 3.0 DKGA_ECOLI
48 PsiBlast_CBE 67.8940% -37 - C5 -4JIH 1.3 AK1BA_HUMAN
15 PsiBlast_PDB 67.7541% -15 - C5 -3CV7 3.6 AK1A1_PIG
53 PsiBlast_CBE 67.6540% -35 - C5 -1ZUA 2.7 AK1BA_HUMAN
44 PsiBlast_CBE 67.5339% -16 - C5 -4GAC 2.2 AK1A1_MOUSE
50 PsiBlast_CBE 67.4440% -36 - C5 -4GQG 2.5 AK1BA_HUMAN
9 PsiBlast_PDB 67.2952% -15 - C5 -1VP5 12.7 ?
52 PsiBlast_CBE 67.2340% -35 - C5 -4I5X 3.0 AK1BA_HUMAN
51 PsiBlast_CBE 67.1640% -39 - C5 -4GQ0 2.4 AK1BA_HUMAN (first)
63 PsiBlast_CBE 66.3540% -12 - C5 -1A80 11.3 DKGA_CORSC
31 PsiBlast_CBE 65.8651% -13 - C5 -3O0K 2.9 ?
32 PsiBlast_CBE 65.3251% -11 - C5 -3O0K 2.7 ?
70 PsiBlast_CBE 65.2137% -8 - C5 -3UZY 9.8 AK1D1_HUMAN
92 PsiBlast_CBE 65.1537% -7 - C5 -3COT 5.0 AK1D1_HUMAN
30 PsiBlast_CBE 65.1551% -4 - C5 -3O0K 2.8 ?
109 HHSearch 65.1451% -9 - C5 -3O0K 2.7 ?
75 PsiBlast_CBE 64.9737% -7 - C5 -3UZW 10.1 AK1D1_HUMAN
88 PsiBlast_CBE 64.9237% -3 - C5 -3G1R 10.2 AK1D1_HUMAN
68 PsiBlast_CBE 64.9037% -7 - C5 -3UZZ 9.7 AK1D1_HUMAN
87 PsiBlast_CBE 64.8737% -1 - C5 -3BUR 7.6 AK1D1_HUMAN
72 PsiBlast_CBE 64.7637% -6 - C5 -3UZX 9.9 AK1D1_HUMAN
90 PsiBlast_CBE 64.7037% -4 - C5 -3DOP 3.8 AK1D1_HUMAN
74 PsiBlast_CBE 64.7037% -5 - C5 -3UZW 9.7 AK1D1_HUMAN
94 PsiBlast_CBE 64.5837% -7 - C5 -3CMF 4.7 AK1D1_HUMAN
84 PsiBlast_CBE 64.5737% 0 - C5 -3BUV 10.7 AK1D1_HUMAN
73 PsiBlast_CBE 64.3237% -6 - C5 -3UZX 9.8 AK1D1_HUMAN
69 PsiBlast_CBE 64.2837% -5 - C5 -3UZZ 9.7 AK1D1_HUMAN
82 PsiBlast_CBE 64.2137% -4 - C5 -3BV7 3.6 AK1D1_HUMAN
86 PsiBlast_CBE 64.0837% -4 - C5 -3BUR 6.0 AK1D1_HUMAN
71 PsiBlast_CBE 64.0437% -5 - C5 -3UZY 9.8 AK1D1_HUMAN
77 PsiBlast_CBE 63.9837% -4 - C5 -3CAV 6.1 AK1D1_HUMAN
91 PsiBlast_CBE 63.9737% -4 - C5 -3DOP 6.0 AK1D1_HUMAN
41 PsiBlast_CBE 63.9541% 2 - C5 -3WBY 4.9 ?
80 PsiBlast_CBE 63.9037% -5 - C5 -3CAQ 2.3 AK1D1_HUMAN
83 PsiBlast_CBE 63.8737% -3 - C5 -3BV7 9.5 AK1D1_HUMAN
62 PsiBlast_CBE 63.7837% -35 - C5 -3H7R 5.1 AKRC8_ARATH
89 PsiBlast_CBE 63.7637% -1 - C5 -3G1R 10.5 AK1D1_HUMAN
76 PsiBlast_CBE 63.6437% -4 - C5 -3CAV 3.3 AK1D1_HUMAN
93 PsiBlast_CBE 63.6037% -1 - C5 -3COT 5.0 AK1D1_HUMAN
10 PsiBlast_PDB 63.5551% -7 - C5 -3O0K 2.7 ?
95 PsiBlast_CBE 63.5237% -3 - C5 -3CMF 5.8 AK1D1_HUMAN
40 PsiBlast_CBE 63.3842% 7 - C5 -3WBW 10.5 ?
78 PsiBlast_CBE 63.3537% 1 - C5 -3CAS 3.1 AK1D1_HUMAN
79 PsiBlast_CBE 63.2637% -1 - C5 -3CAS 6.9 AK1D1_HUMAN
81 PsiBlast_CBE 63.2437% -1 - C5 -3CAQ 1.1 AK1D1_HUMAN
19 PsiBlast_PDB 63.0942% 12 - C5 -3WBW 9.3 ?
42 PsiBlast_CBE 62.9241% 5 - C5 -3WBY 5.4 ?
85 PsiBlast_CBE 62.7837% -1 - C5 -3BUV 6.1 AK1D1_HUMAN
14 PsiBlast_PDB 62.0441% - - C5 -1AE4 2.4 AK1A1_PIG
13 PsiBlast_PDB 62.0341% - - C5 -1CWN 2.8 AK1A1_PIG
56 PsiBlast_CBE 61.0439% 2 - C5 -3WCZ 3.5 AK2E4_BOMMO
57 PsiBlast_CBE 60.8341% -9 - C5 -3H7U 3.0 AKRC9_ARATH
59 PsiBlast_CBE 60.1838% 9 - C5 -2BGS 5.8 ALDR_HORVU
58 PsiBlast_CBE 59.3938% 6 - C5 -2VDG 3.1 ALDR_HORVU
100 PsiBlast_CBE 58.9136% 27 - C5 -3NTY 12.6 AK1C1_HUMAN
98 PsiBlast_CBE 58.8436% 31 - C5 -4YVP 11.9 AK1C1_HUMAN
99 PsiBlast_CBE 58.1136% 32 - C5 -4YVP 12.3 AK1C1_HUMAN
96 PsiBlast_CBE 58.1136% 28 - C5 -3GUG 12.1 AK1C1_HUMAN
97 PsiBlast_CBE 56.6836% 29 - C5 -1MRQ 12.9 AK1C1_HUMAN
64 PsiBlast_CBE 45.6641% 1 - C5 -1AH0 3.8 ALDR_PIG
67 PsiBlast_CBE 44.7841% 3 - C5 -1AH3 3.1 ALDR_PIG
66 PsiBlast_CBE 44.2041% 0 - C5 -1AH4 3.3 ALDR_PIG