@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu29080: (2016-07-16 )
MPELPEVETVRRTLTGLVKGKTIKSVEIRWPNIIKRPAEPEEFARKLAGETIQSIGRRGKFLLFHLDHYVMVSHLRMEGKYGLHQAEEPDDKHVHVIFTMTDGTQLRYRDVRKFGTMHLFKPGEEAGELPLSQLGPEPDAEEFTSAYLKDRLAKTNRAVKTALLDQKTVVGLGNIYVDEALFRAGVHPETKANQLSDKTIKTLHAEIKNTLQEAIDAGGSTVRSYINSQGEIGMFQLQHFVYGKKDEPCKNCGTMISKIVVGGRGTHFCAKCQTKK

Atome Classification :

(68 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_C_3(2XZF)
FPG_LACLC
[Raw transfer]

-

NACID_B_2(3SBJ)
?
[Raw transfer]

-

NACID_B_2(3SAW)
?
[Raw transfer]

-

GOL_A_2(3TWL)
FPG_ARATH
[Raw transfer]




GOL_A_5(3JR5)
?
[Raw transfer]




GOL_A_2(3TWL)
FPG_ARATH
[Raw transfer]




GOL_D_8(3SAR)
?
[Raw transfer]




NACID_C_2(3SAV)
?
[Raw transfer]

-

NACID_B_2(3GQ5)
?
[Raw transfer]

-

TRS_B_2(1TDH)
NEIL1_HUMAN
[Raw transfer]




NACID_C_2(1XC8)
FPG_LACLC
[Raw transfer]

-

NACID_C_2(1TDZ)
FPG_LACLC
[Raw transfer]

-

NACID_E_2(1PJI)
FPG_LACLC
[Raw transfer]

-

NACID_C_3(4PCZ)
FPG_LACLC
[Raw transfer]

-

NACID_C_3(4PDG)
FPG_LACLC
[Raw transfer]

-

NACID_E_2(1PJJ)
FPG_LACLC
[Raw transfer]

-

NACID_E_2(1NNJ)
FPG_LACLC
[Raw transfer]

-

NACID_C_3(2XZU)
FPG_LACLC
[Raw transfer]

-

NACID_B_2(3U6S)
?
[Raw transfer]

-

NACID_B_2(3U6Q)
?
[Raw transfer]

-

NACID_B_2(3GQ3)
?
[Raw transfer]

-

NACID_B_2(3SAU)
?
[Raw transfer]

-

NACID_B_2(3U6M)
?
[Raw transfer]

-

NACID_B_2(3GPY)
?
[Raw transfer]

-

NACID_E_2(1PM5)
FPG_LACLC
[Raw transfer]

-

NACID_C_3(4PD2)
FPG_LACLC
[Raw transfer]

-

NACID_C_1(3C58)
FPG_LACLC
[Raw transfer]

-

NACID_C_3(4PD2)
FPG_LACLC
[Raw transfer]

-

NACID_C_3(3U6D)
?
[Raw transfer]

-

NACID_C_3(4PDI)
FPG_LACLC
[Raw transfer]

-

NACID_B_2(3GP1)
?
[Raw transfer]

-

NACID_B_2(3U6L)
?
[Raw transfer]

-

NACID_B_2(3SAT)
?
[Raw transfer]

-

CHAIN_C_3(4CIS)
?
[Raw transfer]

-

NACID_J_4(1K82)
FPG_ECOLI
[Raw transfer]

-

NACID_B_1(1L1T)
?
[Raw transfer]

-

NACID_I_2(1K82)
FPG_ECOLI
[Raw transfer]

-

NACID_B_2(3GO8)
?
[Raw transfer]

-

NACID_B_1(1L1Z)
?
[Raw transfer]

-

NACID_B_1(1L2C)
?
[Raw transfer]

-

NACID_I_2(1K82)
FPG_ECOLI
[Raw transfer]

-

NACID_B_1(1L1Z)
?
[Raw transfer]

-

NACID_C_3(3U6E)
?
[Raw transfer]

-

NACID_B_1(1R2Z)
?
[Raw transfer]

-

NACID_B_2(3GPP)
?
[Raw transfer]

-

NACID_L_8(1K82)
FPG_ECOLI
[Raw transfer]

-

NACID_B_2(4G4R)
?
[Raw transfer]

-

NACID_B_1(1L2B)
?
[Raw transfer]

-

NACID_B_1(1R2Y)
?
[Raw transfer]

-

NACID_B_2(3JR5)
?
[Raw transfer]

-

NACID_B_1(2F5S)
?
[Raw transfer]

-

NACID_K_6(1K82)
FPG_ECOLI
[Raw transfer]

-

NACID_B_1(2F5N)
?
[Raw transfer]

-

NACID_B_1(2F5O)
?
[Raw transfer]

-

NACID_B_1(1L2D)
?
[Raw transfer]

-

NACID_B_2(4G4Q)
?
[Raw transfer]

-

NACID_B_2(3GPU)
?
[Raw transfer]

-

NACID_C_1(2F5P)
?
[Raw transfer]

-

NACID_B_2(4G4O)
?
[Raw transfer]

-

NACID_B_2(3GPX)
?
[Raw transfer]

-

NACID_C_3(3U6O)
?
[Raw transfer]

-

NACID_B_2(3U6C)
?
[Raw transfer]

-

NACID_B_2(3JR4)
?
[Raw transfer]

-

NACID_B_1(2F5Q)
?
[Raw transfer]

-

NACID_C_3(3U6P)
?
[Raw transfer]

-

NACID_C_3(3U6P)
?
[Raw transfer]

-

NACID_C_2(3SAR)
?
[Raw transfer]

-

NACID_B_2(3GQ4)
?
[Raw transfer]

-

NACID_B_2(4G4N)
?
[Raw transfer]

-

NACID_B_2(3SAS)
?
[Raw transfer]

-

CHAIN_D_4(4CIS)
?
[Raw transfer]

-

12 PsiBlast_PDB 85.7755% -77 - C8 -2F5S 5.9 ?
18 PsiBlast_PDB 85.5655% -79 - C8 -3GPY 5.8 ?
19 PsiBlast_PDB 85.0655% -77 - C8 -3GQ4 4.5 ?
4 PsiBlast_PDB 85.0256% -84 - C8 -1L2C 4.8 ?
7 PsiBlast_PDB 84.9655% -78 - C8 -1R2Z 4.5 ?
36 PsiBlast_CBE 84.8854% -93 - C8 -3U6E 6.2 ?
25 PsiBlast_CBE 84.7155% -97 - C8 -3SAW 8.2 ?
23 PsiBlast_CBE 84.6555% -93 - C8 -3SBJ 5.3 ?
6 PsiBlast_PDB 84.5955% -77 - C8 -1R2Y 5.0 ?
1 PsiBlast_PDB 84.5956% -84 - C8 -1L1T 4.6 ?
39 PsiBlast_CBE 84.5154% -91 - C8 -4G4R 3.9 ?
11 PsiBlast_PDB 84.4855% -74 - C8 -2F5Q 4.7 ?
69 HHSearch 84.4155% -93 - C8 -3U6P 6.1 ?
29 PsiBlast_CBE 84.4154% -93 - C8 -4G4O 6.7 ?
5 PsiBlast_PDB 84.3356% -81 - C8 -1L2D 5.3 ?
21 PsiBlast_CBE 84.2055% -79 - C8 -3JR5 8.4 ?
3 PsiBlast_PDB 84.1656% -79 - C8 -1L2B 5.5 ?
15 PsiBlast_PDB 84.0955% -93 - C8 -3SAV 6.3 ?
31 PsiBlast_CBE 84.0854% -96 - C8 -3U6Q 7.0 ?
2 PsiBlast_PDB 84.0356% -84 - C8 -1L1Z 4.6 ?
32 PsiBlast_CBE 83.9754% -94 - C8 -3U6P 6.1 ?
90 Fugue 83.8955% -83 - C8 -1L1Z 4.6 ?
24 PsiBlast_CBE 83.8555% -94 - C8 -3GP1 7.1 ?
37 PsiBlast_CBE 83.8254% -94 - C8 -3U6D 8.2 ?
9 PsiBlast_PDB 83.8155% -95 - C8 -2F5O 6.5 ?
14 PsiBlast_PDB 83.8055% -97 - C8 -3SAU 6.8 ?
38 PsiBlast_CBE 83.7654% -91 - C8 -3U6C 7.4 ?
17 PsiBlast_PDB 83.7355% -96 - C8 -3GQ5 7.7 ?
34 PsiBlast_CBE 83.7054% -93 - C8 -3U6M 5.5 ?
33 PsiBlast_CBE 83.6354% -94 - C8 -3U6O 6.6 ?
30 PsiBlast_CBE 83.5954% -97 - C8 -3U6S 7.4 ?
13 PsiBlast_PDB 83.5655% -94 - C8 -3SAR 6.3 ?
22 PsiBlast_CBE 83.5055% -93 - C8 -4G4N 6.2 ?
27 PsiBlast_CBE 83.4855% -93 - C8 -3SAS 4.2 ?
40 PsiBlast_CBE 83.3451% -93 - C8 -3GQ3 7.4 ?
16 PsiBlast_PDB 83.3255% -95 - C8 -3GPP 7.3 ?
8 PsiBlast_PDB 83.3255% -92 - C8 -2F5N 6.5 ?
41 PsiBlast_CBE 83.2951% -94 - C8 -3GPX 8.0 ?
35 PsiBlast_CBE 82.9254% -94 - C8 -3U6L 7.2 ?
26 PsiBlast_CBE 82.9055% -90 - C8 -3SAT 5.7 ?
20 PsiBlast_PDB 82.7055% -83 - C8 -3JR4 4.9 ?
42 PsiBlast_CBE 82.4951% -91 - C8 -3GO8 6.9 ?
28 PsiBlast_CBE 82.1955% -89 - C8 -4G4Q 4.9 ?
43 PsiBlast_CBE 81.8551% -92 - C8 -3GPU 7.4 ?
10 PsiBlast_PDB 81.7355% -92 - C8 -2F5P 7.7 ?
70 HHSearch 76.6040% -89 - C8 -1K82 5.4 FPG_ECOLI
47 PsiBlast_CBE 74.5845% 4 - C8 -4PCZ 5.5 FPG_LACLC
51 PsiBlast_CBE 73.9245% 5 - C8 -2XZU 5.7 FPG_LACLC
54 PsiBlast_CBE 73.7845% -0 - C8 -1PM5 5.1 FPG_LACLC
45 PsiBlast_CBE 73.7746% 2 - C8 -4CIS 6.4 ?
44 PsiBlast_CBE 73.7346% -1 - C8 -1TDZ 4.2 FPG_LACLC
56 PsiBlast_CBE 73.4145% -2 - C8 -1PJJ 5.3 FPG_LACLC
53 PsiBlast_CBE 73.3445% 4 * C8 *1XC8 5.3 FPG_LACLC
55 PsiBlast_CBE 72.9845% 0 - C8 -1PJI 5.0 FPG_LACLC
58 PsiBlast_CBE 72.8445% 7 - C8 -4PD2 5.5 FPG_LACLC
46 PsiBlast_CBE 72.8146% -2 - C8 -4CIS 4.8 ?
71 HHSearch 72.7346% 7 - C8 -4PD2 5.5 FPG_LACLC
48 PsiBlast_CBE 72.6045% 2 - C8 -4PDI 5.5 FPG_LACLC
57 PsiBlast_CBE 72.5745% -3 - C8 -1NNJ 5.1 FPG_LACLC
52 PsiBlast_CBE 72.0845% 4 - C8 -2XZF 5.7 FPG_LACLC
50 PsiBlast_CBE 71.4645% 5 - C8 -3C58 5.2 FPG_LACLC
49 PsiBlast_CBE 71.4345% 4 - C8 -4PDG 6.7 FPG_LACLC
59 PsiBlast_CBE 67.2439% 38 - C8 -1K82 7.6 FPG_ECOLI
62 PsiBlast_CBE 66.1039% 35 - C8 -1K82 11.2 FPG_ECOLI
61 PsiBlast_CBE 65.9839% 37 - C8 -1K82 9.4 FPG_ECOLI
60 PsiBlast_CBE 64.3639% 36 - C8 -1K82 5.3 FPG_ECOLI
73 HHSearch 58.5032% 39 - C8 -3TWL 2.9 FPG_ARATH
67 PsiBlast_CBE 56.1031% 11 - C8 -3TWL 2.9 FPG_ARATH