@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu29340: (2016-07-17 )
MIEIKNIHKQFGIHHVLKGINLTVRKGEVVTIIGPSGSGKTTFLRCLNLLERPDEGIISIHDKVINCRFPSKKEVHWLRKQTAMVFQQYHLFAHKTVIENVMEGLTIARKMRKQDAYAVAENELRKVGLQDKLNAYPSQLSGGQKQRVGIARALAIHPDVLLFDEPTAALDPELVGEVLEVMLEIVKTGATMIVVTHEMEFARRVSDQVVFMDEGVIVEQGTPEEVFRHTKKDRTRQFLRRVSPEYLFEPKEHIKEPVI

Atome Classification :

(33 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_6(4YMV)
?
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]




ATP_J_5(4YMU)
?
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ATP_A_5(1L2T)
Y796_METJA
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




ATP_B_6(1L2T)
Y796_METJA
[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




ADP_B_6(2Q0H)
?
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




ADP_A_3(3TIF)
Y796_METJA
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




ADP_B_8(3TIF)
Y796_METJA
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




LMT_B_4(4MKI)
ECFA2_CALS4
[Raw transfer]




LMT_A_7(4MKI)
ECFA2_CALS4
[Raw transfer]




21 PsiBlast_CBE 94.7654%-126 - C1 -4YMV 6.1 ?
2 PsiBlast_PDB 94.2654%-125 - C1 -4YMT - ? -
24 PsiBlast_CBE 93.6953%-130 - C1 -3C4J 5.2 ?
22 PsiBlast_CBE 93.6454%-130 - C1 -4YMU 6.2 ?
4 PsiBlast_PDB 93.1954%-126 - C1 -4YMV 5.0 ?
3 PsiBlast_PDB 92.4854%-126 - C1 -4YMU 6.7 ?
1 PsiBlast_PDB 92.4054%-126 - C1 -4YMS - ? -
5 PsiBlast_PDB 91.6754%-124 - C1 -4YMW - ? -
28 PsiBlast_CBE 91.5953%-131 - C1 -2OUK - ? -
27 PsiBlast_CBE 90.5853%-128 - C1 -2OUK - ? -
7 PsiBlast_PDB 90.5253%-137 - C1 -2OLJ 5.7 ?
12 PsiBlast_PDB 90.3552%-119 - C1 -4U00 6.0 ?
9 PsiBlast_PDB 90.3453%-134 - C1 -2OUK - ? -
30 PsiBlast_CBE 90.2353%-132 - C1 -2OLK 6.3 ?
8 PsiBlast_PDB 89.8153%-133 - C1 -2OLK 6.3 ?
135 HHSearch 89.4153%-120 - C1 -4U00 - ? -
23 PsiBlast_CBE 89.2353%-129 - C1 -3C41 6.0 ?
13 PsiBlast_PDB 88.9952%-118 - C1 -4U02 - ? -
26 PsiBlast_CBE 88.8853%-128 - C1 -2OUK - ? -
6 PsiBlast_PDB 88.7453%-121 - C1 -3C41 6.3 ?
10 PsiBlast_PDB 88.0753%-127 - C1 -2Q0H 5.6 ?
29 PsiBlast_CBE 87.9753%-126 - C1 -2OLK 6.0 ?
25 PsiBlast_CBE 87.8453%-132 - C1 -2Q0H 5.9 ?
11 PsiBlast_PDB 87.0053%-125 - C1 -3C4J 6.7 ?
31 PsiBlast_CBE 86.9153%-126 - C1 -2OLK 6.2 ?
32 PsiBlast_CBE 85.9453%-123 - C1 -2OLJ 5.8 ?
14 PsiBlast_PDB 78.5650% -26 - C1 -1B0U 6.2 HISP_SALTY
79 PsiBlast_CBE 47.9139% -10 - C1 -4MKI 2.0 ECFA2_CALS4
78 PsiBlast_CBE 47.7439% -16 - C1 -4MKI 2.2 ECFA2_CALS4
76 PsiBlast_CBE 44.7834% 14 - C1 -3TIF 6.6 Y796_METJA
72 PsiBlast_CBE 44.3134% 13 - C1 -1L2T 5.3 Y796_METJA
77 PsiBlast_CBE 42.8834% 17 - C1 -3TIF 6.1 Y796_METJA
73 PsiBlast_CBE 42.3434% 13 - C1 -1L2T 6.7 Y796_METJA