@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu29450: (2016-07-17 )
MSEQKKVVLAYSGGLDTSVAIKWLQEQGYNVIACCLDVGEGKDLAFVQQKALEVGATNSYVIDAKEEFAQDYALISLQAHTMYEGKYPLVSALSRPLIAKKLVEIAEKEDAQAIAHGCTGKGNDQVRFEVSIKSLNPDLEVIAPVREWQWSREEEIEYAASRGIPIPINLDSPYSIDQNLWGRANECGILEDPWAAPPEGAYDLTAPLEKTPDTPEVIEIAFEQGVPVSIDGVSYSLSELILKLNEMAGAHGVGRIDHVENRLVGIKSREVYECPGAMTLIKAHKELEDLTLVKEVAHFKPIIEQKMSEIIYNGLWFSPLKDALHAFLKETQKHVTGIVRVKLFKGHAIVEGRKSEYSLYDEKLATYTKDDAFDHHAAIGFIELWGLPTKVNSIVKKKEQIKA

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_B_11(4XFJ)
?
[Raw transfer]




ANP_A_3(4XFJ)
?
[Raw transfer]




ANP_A_3(4XFJ)
?
[Raw transfer]




ASP_A_3(2NZ2)
ASSY_HUMAN
[Raw transfer]




ASP_E_5(1K97)
ASSY_ECOLI
[Raw transfer]




CIR_Q_17(1KP3)
ASSY_ECOLI
[Raw transfer]




CIR_A_4(2NZ2)
ASSY_HUMAN
[Raw transfer]




CIR_A_4(2NZ2)
ASSY_HUMAN
[Raw transfer]




EDO_B_12(4U7J)
?
[Raw transfer]




EDO_A_7(4U7J)
?
[Raw transfer]




49 HHSearch 78.8743% -22 - C4 -2NZ2 2.9 ASSY_HUMAN
2 PsiBlast_PDB 78.2954% 8 - C4 -4XFJ 4.9 ?
8 PsiBlast_PDB 78.2446% -16 - C4 -1J21 - ASSY_THET8 -
50 HHSearch 78.2047% -13 - C4 -1KOR - ASSY_THET8 -
47 HHSearch 78.1547% -23 - C4 -1VL2 - ASSY_THEMA -
33 PsiBlast_CBE 77.9646% -13 - C4 -1KH1 - ASSY_THET8 -
21 PsiBlast_CBE 77.9454% 9 - C4 -4XFJ 4.9 ?
10 PsiBlast_PDB 77.8446% -22 - C4 -1VL2 - ASSY_THEMA -
35 PsiBlast_CBE 77.7946% -13 - C4 -1J21 - ASSY_THET8 -
48 HHSearch 77.6753% 7 - C4 -4XFJ 4.9 ?
4 PsiBlast_PDB 77.5946% -10 - C4 -1KH2 - ASSY_THET8 -
9 PsiBlast_PDB 77.5646% -13 - C4 -1KH3 - ASSY_THET8 -
5 PsiBlast_PDB 77.5646% -13 - C4 -1KOR - ASSY_THET8 -
37 PsiBlast_CBE 77.5446% -13 - C4 -1J21 - ASSY_THET8 -
3 PsiBlast_PDB 77.4646% -8 - C4 -1KH1 - ASSY_THET8 -
29 PsiBlast_CBE 77.4046% -11 - C4 -1KH2 - ASSY_THET8 -
34 PsiBlast_CBE 77.3446% -10 - C4 -1KH1 - ASSY_THET8 -
28 PsiBlast_CBE 77.3346% -10 - C4 -1KH3 - ASSY_THET8 -
39 PsiBlast_CBE 77.2946% -11 - C4 -1J20 - ASSY_THET8 -
30 PsiBlast_CBE 77.2746% -10 - C4 -1KH2 - ASSY_THET8 -
1 PsiBlast_PDB 77.2454% 8 - C4 -4U7J 2.4 ?
12 PsiBlast_PDB 77.0142% -13 - C4 -2NZ2 4.1 ASSY_HUMAN
22 PsiBlast_CBE 75.3554% 10 - C4 -4U7J 2.3 ?