@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu29700: (2016-07-18 )
MIVEQIMKRDVITLTKTDTLETAICKLKEFHIRHLPVVDEERHVIGMITDRDMKQASPSIFEENKRSLFLTRSVDSIMKKDVVCAHPLDFVEEISAVFYEHGIGCLPVVHHQKLIGILTKTDLLRTFVKLTGADQPGSQIEIKVNDITKSLAEISSLCQDLQVKILSVLVYPHDDPGVKVLVFRVKTMNPLPFLQALQRNGHHVVWPSEQRDLL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_4(3LFZ)
Y1225_METJA
[Raw transfer]




AMP_A_3(3KH5)
Y1225_METJA
[Raw transfer]




21 PsiBlast_CBE 71.5432%-157 - C1 -2O16 - ? -
90 HHSearch 69.9032%-173 * C1 *2O16 - ? -
1 PsiBlast_PDB 69.7432%-174 - C1 -2O16 - ? -
7 PsiBlast_PDB 68.0329% -39 - C1 -4ESY - ? -
19 PsiBlast_PDB 67.3426%-165 - C1 -2RC3 - ? -
8 PsiBlast_PDB 65.6334% 5 - C1 -4FRY - ? -
5 PsiBlast_PDB 65.6328%-148 - C1 -3KPB - Y100_METJA -
95 HHSearch 65.5429%-147 - C1 -3KPB - Y100_METJA -
4 PsiBlast_PDB 65.4128%-141 - C1 -3KPC - -
6 PsiBlast_PDB 64.2328%-155 - C1 -3KPD - Y100_METJA -
22 PsiBlast_CBE 63.9334% 7 - C1 -4FRY - ? -
85 HHSearch 63.6623% -96 - C2 -3KH5 - Y1225_METJA -
13 PsiBlast_PDB 63.5724% -75 - C1 -4GQV - CBSX1_ARATH -
91 HHSearch 62.9622% -26 - C1 -3KH5 - Y1225_METJA -
102 HHSearch 62.9031%-122 - C1 -2P9M - Y922_METJA -
93 HHSearch 62.6524%-143 - C1 -1Y5H - HRP1_MYCTU -
94 HHSearch 60.9124%-138 - C1 -1PVM - ? -
3 PsiBlast_PDB 60.1031%-176 - C1 -3LFZ 4.3 Y1225_METJA
2 PsiBlast_PDB 59.6831%-172 - C1 -3KH5 3.4 Y1225_METJA
20 PsiBlast_PDB 59.3823% -73 - C- -1VR9 - ? -