@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu29710: (2016-07-18 )
MRDSVFIYSPSYQTYMFHQEHPFNQQRVLLTYDLLKTINAFDDGDIVTPRLASEEELSLVHTDDYIQAVKLAGAGKLPAEEGESYGLGTEDTPVFAGMHEAASLLVGGTLTAADWVMSGQALHAANLGGGLHHGFRGRASGFCIYNDSAVAIQYIQKKYSARVLYIDTDAHHGDGVQFTFYDNPDVCTLSIHETGRYLFPGTGQIQEKGSGKGYGYSFNIPLDAFTEDDSFLEAYRTAASEVAAYFEPDVIISQNGADAHYYDPLTHLSATINIYEEIPRLAHTLAHQYCGGKWIAVGGGGYDIWRVVPRAWARIWLEMKGIDPGHEIPPEWIVKWQKQCPVALPSSWSDPADLYPPIPRKPEITEKNAQTVSKALYAIRSEQQRTK

Atome Classification :

(85 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_B_15(4A69)
HDAC3_HUMAN
[Raw transfer]




GOL_B_15(4A69)
HDAC3_HUMAN
[Raw transfer]




V5X_B_10(2V5X)
HDAC8_HUMAN
[Raw transfer]




V5X_A_6(2V5X)
HDAC8_HUMAN
[Raw transfer]




SHH_A_6(4QA2)
HDAC8_HUMAN
[Raw transfer]




B3N_A_4(5DC5)
HDAC8_HUMAN
[Raw transfer]




B3N_A_5(1T67)
HDAC8_HUMAN
[Raw transfer]




B3N_B_8(5DC5)
HDAC8_HUMAN
[Raw transfer]




B3N_A_2(4QA4)
HDAC8_HUMAN
[Raw transfer]




B3N_B_11(3F06)
HDAC8_HUMAN
[Raw transfer]




TSN_B_15(1T64)
HDAC8_HUMAN
[Raw transfer]




SHH_A_3(1T69)
HDAC8_HUMAN
[Raw transfer]




SHH_B_10(4QA2)
HDAC8_HUMAN
[Raw transfer]




TSN_B_10(5D1B)
HDAC8_HUMAN
[Raw transfer]




TSN_B_12(3F0R)
HDAC8_HUMAN
[Raw transfer]




TSN_A_13(1T64)
HDAC8_HUMAN
[Raw transfer]




SHH_B_10(4QA0)
HDAC8_HUMAN
[Raw transfer]




B3N_B_10(3MZ3)
HDAC8_HUMAN
[Raw transfer]




B3N_A_6(3MZ4)
HDAC8_HUMAN
[Raw transfer]




TSN_B_12(4QA3)
HDAC8_HUMAN
[Raw transfer]




TSN_A_8(3F0R)
HDAC8_HUMAN
[Raw transfer]




NHB_B_10(1W22)
HDAC8_HUMAN
[Raw transfer]




TSN_C_17(3F0R)
HDAC8_HUMAN
[Raw transfer]




B3N_A_5(3MZ6)
HDAC8_HUMAN
[Raw transfer]




NHB_A_6(1W22)
HDAC8_HUMAN
[Raw transfer]




B3N_A_5(3MZ7)
HDAC8_HUMAN
[Raw transfer]




B3N_A_6(3EZT)
HDAC8_HUMAN
[Raw transfer]




TSN_A_3(4QA3)
HDAC8_HUMAN
[Raw transfer]




B3N_B_11(3EZP)
HDAC8_HUMAN
[Raw transfer]




B3N_A_5(3EW8)
HDAC8_HUMAN
[Raw transfer]




SHH_A_10(4LXZ)
HDAC2_HUMAN
[Raw transfer]




SHH_B_18(4LXZ)
HDAC2_HUMAN
[Raw transfer]




GOL_C_12(5DC8)
HDAC8_HUMAN
[Raw transfer]




SHH_C_24(4LXZ)
HDAC2_HUMAN
[Raw transfer]




B3N_A_6(3F06)
HDAC8_HUMAN
[Raw transfer]




GOL_C_12(5DC8)
HDAC8_HUMAN
[Raw transfer]




AGE_A_8(3F07)
HDAC8_HUMAN
[Raw transfer]




AGE_B_12(3F07)
HDAC8_HUMAN
[Raw transfer]




B3N_B_11(3EZT)
HDAC8_HUMAN
[Raw transfer]




GOL_B_11(5D1C)
HDAC8_HUMAN
[Raw transfer]




TSN_A_5(1C3R)
?
[Raw transfer]




TSN_B_6(1C3R)
?
[Raw transfer]




GOL_A_7(5DC6)
HDAC8_HUMAN
[Raw transfer]




GOL_A_7(5DC7)
HDAC8_HUMAN
[Raw transfer]




GOL_D_11(5DC6)
HDAC8_HUMAN
[Raw transfer]




GOL_D_12(5DC7)
HDAC8_HUMAN
[Raw transfer]




GOL_D_14(4QA6)
HDAC8_HUMAN
[Raw transfer]




SHH_A_3(1C3S)
?
[Raw transfer]




LLX_C_16(3MAX)
HDAC2_HUMAN
[Raw transfer]




LLX_B_12(3MAX)
HDAC2_HUMAN
[Raw transfer]




LLX_A_7(3MAX)
HDAC2_HUMAN
[Raw transfer]




20Y_A_10(4LY1)
HDAC2_HUMAN
[Raw transfer]




20Y_B_18(4LY1)
HDAC2_HUMAN
[Raw transfer]




20Y_C_24(4LY1)
HDAC2_HUMAN
[Raw transfer]




1DI_A_8(3SFH)
HDAC8_HUMAN
[Raw transfer]




CHAIN_D_4(4QA5)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_C_3(4QA5)
HDAC8_HUMAN
[Raw transfer]

-

0DI_A_2(3SFF)
HDAC8_HUMAN
[Raw transfer]




20Y_A_10(4LY1)
HDAC2_HUMAN
[Raw transfer]




CHAIN_C_3(3RQD)
HDAC8_HUMAN
[Raw transfer]

-

B3N_A_6(3MZ4)
HDAC8_HUMAN
[Raw transfer]




CHAIN_D_4(3RQD)
HDAC8_HUMAN
[Raw transfer]

-

MCM_D_13(4QA6)
HDAC8_HUMAN
[Raw transfer]




MCM_D_14(4QA5)
HDAC8_HUMAN
[Raw transfer]




L8G_B_12(4RN1)
HDAC8_HUMAN
[Raw transfer]




TSN_B_10(5D1B)
HDAC8_HUMAN
[Raw transfer]




L8G_A_6(4RN1)
HDAC8_HUMAN
[Raw transfer]




L7G_A_6(4RN2)
HDAC8_HUMAN
[Raw transfer]




L6G_B_9(4RN0)
HDAC8_HUMAN
[Raw transfer]




L7G_B_10(4RN2)
HDAC8_HUMAN
[Raw transfer]




L6G_A_3(4RN0)
HDAC8_HUMAN
[Raw transfer]




B3N_B_10(3MZ3)
HDAC8_HUMAN
[Raw transfer]




B3N_B_11(3EZP)
HDAC8_HUMAN
[Raw transfer]




CHAIN_L_8(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_J_6(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_I_5(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_K_7(3EWF)
HDAC8_HUMAN
[Raw transfer]

-

IMD_A_7(4RN0)
HDAC8_HUMAN
[Raw transfer]




SHH_B_10(4QA0)
HDAC8_HUMAN
[Raw transfer]




IMD_A_7(4RN1)
HDAC8_HUMAN
[Raw transfer]




CHAIN_B_2(4QA7)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_D_4(4QA6)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_L_5(2V5W)
HDAC8_HUMAN
[Raw transfer]

-

TSN_B_12(4QA3)
HDAC8_HUMAN
[Raw transfer]




CHAIN_C_3(4QA6)
HDAC8_HUMAN
[Raw transfer]

-

CHAIN_I_4(2V5W)
HDAC8_HUMAN
[Raw transfer]

-

102 Fugue 89.0529% -37 - C2 -4QA5 - HDAC8_HUMAN -
86 PsiBlast_CBE 87.7831% -51 - C2 -5DC7 2.6 HDAC8_HUMAN
90 PsiBlast_CBE 87.2032% -46 - C2 -4QA0 4.8 HDAC8_HUMAN
17 PsiBlast_PDB 87.1932% -49 - C2 -3F0R 4.5 HDAC8_HUMAN
114 HHSearch 87.0535% -26 - C2 -1C3P - ? -
83 PsiBlast_CBE 86.8232% -46 - C2 -3EWF 4.1 HDAC8_HUMAN
11 PsiBlast_PDB 86.7532% -46 - C2 -4QA4 4.0 HDAC8_HUMAN
61 PsiBlast_CBE 86.5532% -45 - C2 -2V5W 6.6 HDAC8_HUMAN
60 PsiBlast_CBE 86.4232% -48 - C2 -4QA7 3.4 HDAC8_HUMAN
84 PsiBlast_CBE 86.2632% -45 - C2 -3EWF 5.4 HDAC8_HUMAN
91 PsiBlast_CBE 86.2332% -45 * C2 *4QA0 2.6 HDAC8_HUMAN
44 PsiBlast_CBE 86.2332% -42 - C2 -4QA2 4.3 HDAC8_HUMAN
43 PsiBlast_CBE 86.1732% -44 - C2 -1T64 5.2 HDAC8_HUMAN
28 PsiBlast_CBE 86.1032% -42 - C2 -4QA1 - HDAC8_HUMAN -
57 PsiBlast_CBE 86.0132% -45 - C2 -5D1C - HDAC8_HUMAN -
65 PsiBlast_CBE 85.9032% -51 - C2 -5DC5 4.8 HDAC8_HUMAN
82 PsiBlast_CBE 85.8732% -46 - C2 -3EWF 5.1 HDAC8_HUMAN
87 PsiBlast_CBE 85.8431% -47 - C2 -5DC7 2.5 HDAC8_HUMAN
56 PsiBlast_CBE 85.8132% -47 - C2 -5D1C 2.4 HDAC8_HUMAN
70 PsiBlast_CBE 85.7832% -44 - C2 -5D1D - HDAC8_HUMAN -
18 PsiBlast_PDB 85.7732% -43 - C2 -1T64 5.1 HDAC8_HUMAN
85 PsiBlast_CBE 85.7432% -46 - C2 -3EWF 4.3 HDAC8_HUMAN
16 PsiBlast_PDB 85.7432% -47 - C2 -3F07 4.3 HDAC8_HUMAN
31 PsiBlast_CBE 85.7132% -46 - C2 -4QA5 5.0 HDAC8_HUMAN
36 PsiBlast_CBE 85.5332% -46 - C2 -3F0R 4.5 HDAC8_HUMAN
74 PsiBlast_CBE 85.5231% -48 - C2 -5DC6 2.6 HDAC8_HUMAN
10 PsiBlast_PDB 85.5232% -46 - C2 -4QA3 4.3 HDAC8_HUMAN
9 PsiBlast_PDB 85.1932% -44 - C2 -4QA5 4.8 HDAC8_HUMAN
75 PsiBlast_CBE 85.1132% -44 - C2 -5D1B 4.2 HDAC8_HUMAN
113 HHSearch 85.0131% -39 - C2 -4A69 Error HDAC3_HUMAN
63 PsiBlast_CBE 84.9632% -43 - C2 -4QA6 4.7 HDAC8_HUMAN
64 PsiBlast_CBE 84.9332% -44 - C2 -4QA6 3.0 HDAC8_HUMAN
59 PsiBlast_CBE 84.8832% -43 - C2 -2V5X 6.7 HDAC8_HUMAN
81 PsiBlast_CBE 84.7532% -50 - C2 -3MZ4 3.3 HDAC8_HUMAN
89 PsiBlast_CBE 84.7331% -47 - C2 -5DC8 2.6 HDAC8_HUMAN
58 PsiBlast_CBE 84.3732% -49 - C2 -2V5X 5.8 HDAC8_HUMAN
49 PsiBlast_CBE 84.2932% -49 - C2 -3EZT 3.8 HDAC8_HUMAN
78 PsiBlast_CBE 84.2732% -50 - C2 -3MZ7 3.1 HDAC8_HUMAN
73 PsiBlast_CBE 84.2531% -44 - C2 -5DC6 2.7 HDAC8_HUMAN
80 PsiBlast_CBE 84.2332% -50 - C2 -3MZ4 2.5 HDAC8_HUMAN
19 PsiBlast_PDB 84.2032% -48 - C2 -1T67 4.2 HDAC8_HUMAN
62 PsiBlast_CBE 84.1632% -42 - C2 -2V5W 6.7 HDAC8_HUMAN
112 HHSearch 84.0230% -43 - C2 -5DC8 2.6 HDAC8_HUMAN
66 PsiBlast_CBE 83.6532% -47 - C2 -5DC5 5.0 HDAC8_HUMAN
79 PsiBlast_CBE 83.5432% -51 - C2 -3MZ6 3.4 HDAC8_HUMAN
48 PsiBlast_CBE 83.5232% -48 - C2 -3EZT 3.7 HDAC8_HUMAN
38 PsiBlast_CBE 83.1332% -45 - C2 -3F07 4.7 HDAC8_HUMAN
77 PsiBlast_CBE 83.1032% -48 - C2 -3EW8 3.1 HDAC8_HUMAN
33 PsiBlast_CBE 83.1032% -48 - C2 -3RQD 4.2 HDAC8_HUMAN
76 PsiBlast_CBE 83.0832% -45 - C2 -5D1B 2.7 HDAC8_HUMAN
55 PsiBlast_CBE 82.6932% -49 - C2 -4RN0 3.9 HDAC8_HUMAN
20 PsiBlast_PDB 82.4332% -47 - C2 -1T69 3.3 HDAC8_HUMAN
1 PsiBlast_PDB 82.4134% -31 - C2 -1C3R 5.0 ?
40 PsiBlast_CBE 82.3232% -48 - C2 -1W22 4.1 HDAC8_HUMAN
13 PsiBlast_PDB 82.2832% -47 - C2 -3RQD 4.3 HDAC8_HUMAN
21 PsiBlast_CBE 82.2634% -33 - C2 -1C3R 4.7 ?
53 PsiBlast_CBE 82.2432% -48 - C2 -4RN1 3.7 HDAC8_HUMAN
2 PsiBlast_PDB 82.1334% -36 - C2 -1C3S 4.2 ?
45 PsiBlast_CBE 82.0732% -47 - C2 -4QA2 3.8 HDAC8_HUMAN
32 PsiBlast_CBE 81.9132% -46 - C2 -4QA3 4.4 HDAC8_HUMAN
52 PsiBlast_CBE 81.5632% -46 - C2 -4RN1 3.3 HDAC8_HUMAN
35 PsiBlast_CBE 81.5232% -48 - C2 -3F0R 4.5 HDAC8_HUMAN
39 PsiBlast_CBE 81.3632% -46 - C2 -1W22 4.0 HDAC8_HUMAN
115 HHSearch 81.3432% -30 - C2 -4LY1 6.2 HDAC2_HUMAN
51 PsiBlast_CBE 81.3432% -47 - C2 -4RN2 3.4 HDAC8_HUMAN
68 PsiBlast_CBE 80.6632% -46 - C2 -3EZP 2.1 HDAC8_HUMAN
12 PsiBlast_PDB 80.2932% -47 - C2 -3MZ3 2.5 HDAC8_HUMAN
34 PsiBlast_CBE 80.1832% -48 - C2 -3MZ3 4.2 HDAC8_HUMAN
67 PsiBlast_CBE 79.9932% -46 - C2 -3EZP 3.7 HDAC8_HUMAN
50 PsiBlast_CBE 79.9232% -48 - C2 -4RN2 3.3 HDAC8_HUMAN
54 PsiBlast_CBE 79.7032% -44 - C2 -4RN0 3.8 HDAC8_HUMAN
71 PsiBlast_CBE 79.5332% -48 - C2 -3F06 3.8 HDAC8_HUMAN
15 PsiBlast_PDB 78.9832% -50 - C2 -3SFH 6.2 HDAC8_HUMAN
72 PsiBlast_CBE 78.9532% -49 - C2 -3F06 4.1 HDAC8_HUMAN
14 PsiBlast_PDB 77.4532% -49 - C2 -3SFF 6.5 HDAC8_HUMAN
47 PsiBlast_CBE 76.9831% -37 - C2 -4A69 Error HDAC3_HUMAN
26 PsiBlast_CBE 66.9033% -17 - C2 -4LXZ 5.1 HDAC2_HUMAN
24 PsiBlast_CBE 66.2533% -16 - C2 -4LY1 5.7 HDAC2_HUMAN
22 PsiBlast_CBE 65.6533% -19 - C2 -3MAX 5.9 HDAC2_HUMAN
6 PsiBlast_PDB 65.6433% -18 - C2 -4LXZ 5.2 HDAC2_HUMAN
5 PsiBlast_PDB 65.2533% -16 - C2 -3MAX 6.3 HDAC2_HUMAN
7 PsiBlast_PDB 64.2833% -16 - C2 -4LY1 5.4 HDAC2_HUMAN
27 PsiBlast_CBE 64.2633% -14 - C2 -4LXZ 5.3 HDAC2_HUMAN
25 PsiBlast_CBE 63.9233% -15 - C2 -4LY1 5.2 HDAC2_HUMAN
23 PsiBlast_CBE 63.4033% -14 - C2 -3MAX 5.7 HDAC2_HUMAN