@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu29970: (2016-07-18 )
MLKIVANTADLIGDTPLVRLNRLQPENAAQVYLKLEFFNPSGSVKDRAAYQMIIEAEQNGLLKPGSVIIEPTSGNTGIGLAMNAAARGYKAILVMPDTMTKERINLLKAYGAEVVLTPGEERMPGSIKKAKELAEQIPNSYIPMQFDNTANPDAHRKTTAPEIARAIEEIGKPLGAFVASSGTGGTITGTGEALKELFPDITVHVVEPAGSPVLSGGKPGAHKLVGTSPGFIPPILNEDVYDEIIKISDEDAYTTTRRLAAEEGILVGPSSGAACFAAIETAKRLSPDKVVVCMTADTGERYLSTDLWSFI

Atome Classification :

(68 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PUS_A_3(3X44)
DCSD_STRLA
[Raw transfer]




PUS_A_3(3X44)
DCSD_STRLA
[Raw transfer]




PUS_B_4(3X44)
DCSD_STRLA
[Raw transfer]




PDA_A_2(2Q3D)
CYSK_MYCTU
[Raw transfer]




P1T_A_3(3PC3)
?
[Raw transfer]




AA5_A_2(1Z7Y)
CYSK1_ARATH
[Raw transfer]




AWH_A_3(3ZEI)
CYSK_MYCTU
[Raw transfer]




CIT_A_4(2V03)
CYSM_ECOLI
[Raw transfer]




4AT_B_6(2EFY)
?
[Raw transfer]




4AT_A_4(2EFY)
?
[Raw transfer]




CIT_A_4(2V03)
CYSM_ECOLI
[Raw transfer]




CYS_A_2(4LMB)
?
[Raw transfer]




CHAIN_B_2(2Q3C)
CYSK_MYCTU
[Raw transfer]

-

PLP_E_5(1D6S)
CYSK_SALTY
[Raw transfer]




PLP_D_4(1D6S)
CYSK_SALTY
[Raw transfer]




4MV_A_3(2ECO)
?
[Raw transfer]




PLP_B_5(4L0D)
CBS_HUMAN
[Raw transfer]




PLP_A_3(4L0D)
CBS_HUMAN
[Raw transfer]




PLP_A_5(2PQM)
?
[Raw transfer]




PLP_B_7(4LMA)
?
[Raw transfer]




PLP_A_3(4AEC)
CYSKM_ARATH
[Raw transfer]




PLP_A_4(4LMB)
?
[Raw transfer]




PLP_B_5(4AEC)
CYSKM_ARATH
[Raw transfer]




PLP_A_2(2ECQ)
?
[Raw transfer]




PLP_A_3(4AEC)
CYSKM_ARATH
[Raw transfer]




PLP_A_3(2EFY)
?
[Raw transfer]




PLP_B_7(4PCU)
CBS_HUMAN
[Raw transfer]




PLP_A_5(4LMA)
?
[Raw transfer]




PLP_A_3(1OAS)
CYSK_SALTY
[Raw transfer]




PLP_A_5(4COO)
CBS_HUMAN
[Raw transfer]




PLP_A_3(1OAS)
CYSK_SALTY
[Raw transfer]




PLP_A_4(4PCU)
CBS_HUMAN
[Raw transfer]




PLP_A_3(1Z7W)
CYSK1_ARATH
[Raw transfer]




PLP_C_14(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_A_13(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_A_5(3VBE)
?
[Raw transfer]




PLP_B_6(3VBE)
?
[Raw transfer]




PLP_B_4(1OAS)
CYSK_SALTY
[Raw transfer]




PLP_B_15(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_A_3(1VE1)
?
[Raw transfer]




PLP_B_5(2EFY)
?
[Raw transfer]




PLP_D_16(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_A_3(1VE1)
?
[Raw transfer]




PLP_A_4(4LMB)
?
[Raw transfer]




PLP_A_2(2ECO)
?
[Raw transfer]




PLP_A_3(1Z7W)
CYSK1_ARATH
[Raw transfer]




MPD_A_6(2Q3B)
CYSK_MYCTU
[Raw transfer]




MPD_A_6(2Q3B)
CYSK_MYCTU
[Raw transfer]




PLP_C_9(2BHS)
CYSM_ECOLI
[Raw transfer]




PLP_D_8(3VBE)
?
[Raw transfer]




PLP_B_8(2BHS)
CYSM_ECOLI
[Raw transfer]




PLP_A_4(3DWG)
CYSM_MYCTU
[Raw transfer]




PLP_A_7(2BHS)
CYSM_ECOLI
[Raw transfer]




PLP_D_11(2BHS)
CYSM_ECOLI
[Raw transfer]




CYS_A_3(4LMB)
?
[Raw transfer]




3HL_A_3(2ECQ)
?
[Raw transfer]




OAS_B_3(5HBG)
CYSM_HELPY
[Raw transfer]




CHAIN_P_3(1Y7L)
CYSK_HAEIN
[Raw transfer]

-

MPD_A_4(2Q3B)
CYSK_MYCTU
[Raw transfer]




CHAIN_B_2(3TBH)
?
[Raw transfer]

-

CHAIN_B_3(2ISQ)
CYSK1_ARATH
[Raw transfer]

-

16 PsiBlast_PDB 91.0053% -90 - C- -3RR2 - ? -
14 PsiBlast_PDB 88.1352% -78 - C3 -2Q3B 3.5 CYSK_MYCTU
12 PsiBlast_PDB 87.8452% -82 - C3 -3ZEI 6.3 CYSK_MYCTU
13 PsiBlast_PDB 87.7852% -69 - C3 -2Q3D 8.1 CYSK_MYCTU
114 HHSearch 85.8558% -96 - C3 -2EGU - ? -
55 PsiBlast_CBE 85.6646% -79 - C3 -3X43 - DCSD_STRLA -
15 PsiBlast_PDB 85.3052% -80 - C3 -2Q3C 5.0 CYSK_MYCTU
11 PsiBlast_PDB 85.2857% -98 - C3 -2EGU - ? -
17 PsiBlast_PDB 84.9853% -98 - C3 -4I1Y - ? -
31 PsiBlast_CBE 84.7153%-104 - C3 -4I1Y - ? -
57 PsiBlast_CBE 84.4746% -77 - C3 -3X43 - DCSD_STRLA -
52 PsiBlast_CBE 84.3446% -78 - C3 -3X43 - DCSD_STRLA -
56 PsiBlast_CBE 83.6946% -78 - C3 -3X43 - DCSD_STRLA -
53 PsiBlast_CBE 83.4846% -74 - C3 -3X43 - DCSD_STRLA -
51 PsiBlast_CBE 83.3746% -78 - C3 -3X43 - DCSD_STRLA -
81 PsiBlast_CBE 83.2946% -70 - C3 -3X44 7.3 DCSD_STRLA
80 PsiBlast_CBE 82.8946% -71 - C3 -3X44 4.2 DCSD_STRLA
50 PsiBlast_CBE 82.8946% -74 - C3 -3X43 - DCSD_STRLA -
54 PsiBlast_CBE 82.6246% -74 - C3 -3X43 - DCSD_STRLA -
107 PsiBlast_CBE 81.3243% -79 - C3 -4OFX - ? -
117 HHSearch 80.2950% -9 - C3 -4AEC 3.9 CYSKM_ARATH
37 PsiBlast_CBE 80.2649% -6 - C3 -4AEC 4.0 CYSKM_ARATH
25 PsiBlast_PDB 80.1649% -10 - C3 -4AEC 3.9 CYSKM_ARATH
111 HHSearch 78.9051% -17 - C3 -2Q3B 3.2 CYSK_MYCTU
115 HHSearch 78.4745% -38 - C3 -3X44 7.3 DCSD_STRLA
130 HHSearch 77.2245% -70 - C3 -2V03 1.8 CYSM_ECOLI
28 PsiBlast_PDB 76.7648% -14 - C3 -1Z7Y 3.3 CYSK1_ARATH
110 PsiBlast_CBE 76.3245% 3 - C3 -1D6S 5.0 CYSK_SALTY
109 PsiBlast_CBE 76.0145% 3 - C3 -1D6S 4.9 CYSK_SALTY
118 HHSearch 75.8049% -6 - C3 -1Z7W 4.2 CYSK1_ARATH
27 PsiBlast_PDB 75.4948% -5 - C3 -2ISQ 5.8 CYSK1_ARATH
26 PsiBlast_PDB 75.3448% -7 - C3 -1Z7W 4.2 CYSK1_ARATH
22 PsiBlast_PDB 74.9651% 18 - C3 -2EFY 4.7 ?
121 HHSearch 74.7243% -14 - C3 -3TBH 2.6 ?
21 PsiBlast_PDB 73.8451% 19 - C3 -2ECQ 4.0 ?
35 PsiBlast_CBE 73.5251% 18 - C3 -2EFY 4.2 ?
40 PsiBlast_CBE 73.4345% -50 - C3 -2BHS 3.6 CYSM_ECOLI
1 Fugue 73.4147% 1 - C3 -1OAS 3.6 CYSK_SALTY
39 PsiBlast_CBE 73.3845% -49 - C3 -2BHS 3.7 CYSM_ECOLI
102 PsiBlast_CBE 73.3545% 4 - C3 -1OAS 3.6 CYSK_SALTY
122 HHSearch 73.3346% -3 - C3 -1Y7L 4.4 CYSK_HAEIN
101 PsiBlast_CBE 73.3245% 4 - C3 -1OAS 3.6 CYSK_SALTY
41 PsiBlast_CBE 73.2745% -48 - C3 -2BHS 3.4 CYSM_ECOLI
90 PsiBlast_CBE 73.2244% -50 - C3 -2V03 2.3 CYSM_ECOLI
20 PsiBlast_PDB 73.0651% 19 - C3 -2ECO 4.6 ?
124 HHSearch 72.8450% 20 - C3 -1VE1 3.8 ?
38 PsiBlast_CBE 72.6245% -49 - C3 -2BHS 4.1 CYSM_ECOLI
19 PsiBlast_PDB 72.6051% 19 - C3 -1VE1 3.8 ?
93 PsiBlast_CBE 71.9043% -2 - C3 -3VBE 4.1 ?
94 PsiBlast_CBE 71.8343% -1 - C3 -3VBE 3.2 ?
123 HHSearch 71.7148% 30 - C3 -4LMB 4.1 ?
91 PsiBlast_CBE 71.3243% -1 - C3 -3VBE 3.7 ?
106 PsiBlast_CBE 71.3145% 6 - C3 -1FCJ 3.1 CYSK_SALTY
105 PsiBlast_CBE 71.1645% 10 - C3 -1FCJ 3.4 CYSK_SALTY
103 PsiBlast_CBE 71.0645% 4 - C3 -1FCJ 3.3 CYSK_SALTY
23 PsiBlast_PDB 70.8149% 26 - C3 -4LMA 4.1 ?
36 PsiBlast_CBE 70.7349% 22 - C3 -4LMA 4.6 ?
104 PsiBlast_CBE 70.5545% 10 - C3 -1FCJ 3.1 CYSK_SALTY
24 PsiBlast_PDB 70.3747% 25 - C3 -4LMB 4.1 ?
45 PsiBlast_CBE 70.0941% 22 - C3 -4L0D 3.6 CBS_HUMAN
46 PsiBlast_CBE 70.0741% 25 - C3 -4L0D 4.1 CBS_HUMAN
43 PsiBlast_CBE 69.4542% 26 - C3 -4PCU 3.5 CBS_HUMAN
59 PsiBlast_CBE 69.0041% 31 - C3 -4COO 4.4 CBS_HUMAN
129 HHSearch 68.7741% 25 - C3 -3PC3 8.3 ?
44 PsiBlast_CBE 68.2842% 24 - C3 -4PCU 3.0 CBS_HUMAN
125 HHSearch 67.9341% 20 - C3 -2PQM 3.6 ?
42 PsiBlast_CBE 67.4343% 34 - C3 -5HBG 0.4 CYSM_HELPY
128 HHSearch 63.3038% 22 - C3 -3DWG 5.2 CYSM_MYCTU