@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu30010: (2016-07-19 )
MTNLLEASIEQAGYTSRKKVLTDVFLEVRKGELVGLIGANGAGKSTAIKAILGLSEDFKGHIAWNDCSFAYIPEHPSFYEELTLWEHLDLISTLHGIEESEFAHRAQSLLQTFSLDHVKHELPVTFSKGMQQKLMLIQAFLSKPDMYVIDEPFIGLDPISTKRFVDMLKAEKERGAGILMCTHVLDTAEKICDRFYMIEKGSLFLQGTLKDVQDKTGLEGQSLLDCFYKAVQGDRL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_J_5(4YMV)
?
[Raw transfer]




ATP_A_2(1JI0)
?
[Raw transfer]




GOL_B_11(4P33)
LPTB_ECOLI
[Raw transfer]




40 HHSearch 87.9747% -29 - C1 -4RVC - ? -
1 PsiBlast_PDB 81.9744% -27 - C1 -4RVC - ? -
2 PsiBlast_PDB 72.1829% -19 - C1 -4WBS - ? -
7 PsiBlast_PDB 69.2125% -19 - C1 -1VPL - ? -
42 Fugue 67.1127% -14 - C1 -3TUZ - METN_ECOLI -
31 HHSearch 65.6927% -12 - C1 -3TUI - METN_ECOLI -
39 HHSearch 64.8323% -34 - C1 -4FWI - ? -
4 PsiBlast_PDB 61.8927% -22 - C1 -4P32 - LPTB_ECOLI -
12 PsiBlast_PDB 61.6631% -49 - C1 -1JI0 4.7 ?
16 PsiBlast_PDB 61.2726% -30 - C1 -4YMT - ? -
5 PsiBlast_PDB 61.1727% -25 - C1 -4P31 - LPTB_ECOLI -
15 PsiBlast_PDB 61.1226% -30 - C1 -4YMS - ? -
19 PsiBlast_PDB 60.8326% -33 - C1 -4YMW - ? -
29 HHSearch 60.0219% -40 - C1 -3RLF - MALK_ECOLI -
9 PsiBlast_PDB 59.5028% -25 - C1 -3TUI - METN_ECOLI -
17 PsiBlast_PDB 59.1726% -30 - C1 -4YMU - ? -
18 PsiBlast_PDB 59.0326% -31 - C1 -4YMV 4.2 ?
3 PsiBlast_PDB 58.8327% -20 - C1 -4QC2 - ? -
11 PsiBlast_PDB 58.2928% -33 - C1 -3TUJ - METN_ECOLI -
8 PsiBlast_PDB 58.2128% -28 - C1 -3DHW - METN_ECOLI -