@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu30450: (2016-07-20 )
MIELRQLSKAIDGNQVLKDVSLTIEKGEIFGLLGRNGSGKTTMLRLIQQIIFADSGTILFDGVEIKKHPKVKQNIIYMPVQNPFYDKYTYKQLVDILRRIYPKFDVTYANELMNRYEIPETKKYRELSTGLKKQLSLVLSFAARPALILLDEPTDGIDAVTRHDVLQLMVDEVAERDTSILITSHRLEDIERMCNRIGFLEDNSLTNVMDLDELKEEYIKIQMAFDTDVNLAIREQNIPMLDQAGVFYTVLIPKSDEEKKSFLRELKPKVWNELPVNLEEVFIAKFGGKRRW

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LMT_A_7(4MKI)
ECFA2_CALS4
[Raw transfer]




7 PsiBlast_PDB 74.3024% -55 - C1 -4RVC - ? -
1 PsiBlast_PDB 70.8530% -14 - C1 -1VPL - ? -
29 HHSearch 68.6825% -18 - C1 -3FVQ - FBPC_NEIG1 -
2 PsiBlast_PDB 68.6429% 1 - C1 -4P32 - LPTB_ECOLI -
27 HHSearch 68.3726% -40 - C1 -3D31 - ? -
5 PsiBlast_PDB 66.8328% 1 - C1 -4P31 - LPTB_ECOLI -
22 HHSearch 66.1123% -9 - C1 -4YER - ? -
30 HHSearch 65.5923% -25 - C1 -2YYZ - ? -
3 PsiBlast_PDB 65.3429% 11 - C1 -4QC2 - ? -
34 HHSearch 64.9021% -2 - C1 -4HUQ - ECFA2_LACBA -
6 PsiBlast_PDB 63.5627% -31 - C1 -4WBS - ? -
4 PsiBlast_PDB 62.7728% 9 - C1 -4P33 - LPTB_ECOLI -
16 PsiBlast_PDB 61.0026% -51 - C1 -4YMV - ? -
23 HHSearch 59.7425% 18 - C1 -1Z47 - ? -
15 PsiBlast_PDB 59.2726% -50 - C1 -4YMU - ? -
13 PsiBlast_PDB 59.2526% -49 - C1 -4YMS - ? -
31 HHSearch 58.7220% -36 - C1 -3RLF - MALK_ECOLI -
14 PsiBlast_PDB 58.4326% -50 - C1 -4YMT - ? -
25 HHSearch 58.3524% -21 - C1 -2IT1 - ? -
33 HHSearch 58.1223% 4 * C1 *3TUI - METN_ECOLI -