@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu30610: (2016-07-20 )
MSFLHVDHVTHTYFSIKEKTTAVRDIHFDAEKGDFISFLGPSGCGKTTLLSIIAGLIEPSEGRVLIEGREPNQKEHNIGYMLQQDYLFPWKSIEENVLLGLKIADTLTEESKAAALGLLPEFGLIDVEKKYPKELSGGMRQRAALARTLAPNPSLLLLDEPFSALDFQTKLSLENLVFRTLKEYQKTAVLVTHDIGEAIAMSDTIFLFSNQPGTIHQIFTIPKELAAMLPFDARQEPSFQTLFQTIWKELNSLEKQQRNH

Atome Classification :

(53 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_7(4YMU)
?
[Raw transfer]




ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




ATP_A_5(1L2T)
Y796_METJA
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




ATP_B_6(1L2T)
Y796_METJA
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




ADP_A_3(3TIF)
Y796_METJA
[Raw transfer]




ATP_E_5(2FGJ)
HLYBP_ECOLX
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ATP_A_9(1XEF)
HLYBP_ECOLX
[Raw transfer]




ADP_B_8(3TIF)
Y796_METJA
[Raw transfer]




ADP_C_11(4HLU)
ECFA1_THEMA
[Raw transfer]




ADP_A_3(4YER)
?
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




ATP_D_12(1XEF)

[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




ATP_B_10(1XEF)
HLYBP_ECOLX
[Raw transfer]




ATP_G_7(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ATP_H_8(2FGJ)

[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




ADP_D_7(4HLU)
ECFA1_THEMA
[Raw transfer]




ATP_C_11(1XEF)
HLYBP_ECOLX
[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




ATP_C_3(1VCI)
?
[Raw transfer]




ATP_F_6(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ADP_A_6(3BK7)
?
[Raw transfer]




ADP_B_2(2FFA)

[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




ADP_B_3(3J15)
?
[Raw transfer]




104 Fugue 81.5033% -13 - C1 -1OXS - ? -
115 HHSearch 72.2337% -58 - C1 -1Z47 - ? -
122 HHSearch 71.9436% -62 - C1 -3RLF - MALK_ECOLI -
107 Fugue 71.8131% 7 - C1 -1Z47 - ? -
21 PsiBlast_CBE 71.2539% -29 - C1 -1Z47 - ? -
35 PsiBlast_CBE 70.8335% -36 - C1 -3FVQ - FBPC_NEIG1 -
108 Fugue 70.6228% -33 - C1 -3TUZ - METN_ECOLI -
24 PsiBlast_CBE 69.3934% -61 - C1 -3PUZ - MALK_ECOLI -
12 PsiBlast_PDB 69.0234% -62 - C1 -3PUW - MALK_ECOLI -
16 PsiBlast_PDB 68.9034% -65 - C1 -4KHZ - ? -
36 PsiBlast_CBE 68.7435% -33 - C1 -3FVQ - FBPC_NEIG1 -
13 PsiBlast_PDB 68.2634% -63 - C1 -3PUX - MALK_ECOLI -
17 PsiBlast_PDB 68.1234% -64 - C1 -4KI0 - MALK_ECOLI -
11 PsiBlast_PDB 68.1034% -64 - C1 -3PUV - MALK_ECOLI -
25 PsiBlast_CBE 68.0834% -64 - C1 -3PUY - MALK_ECOLI -
23 PsiBlast_CBE 68.0634% -59 - C1 -3RLF - MALK_ECOLI -
27 PsiBlast_CBE 67.4734% -60 - C1 -3PUW - MALK_ECOLI -
14 PsiBlast_PDB 67.3734% -63 - C1 -3RLF - MALK_ECOLI -
15 PsiBlast_PDB 67.1934% -63 - C1 -4JBW - MALK_ECOLI -
22 PsiBlast_CBE 66.7534% -59 - C1 -4KI0 - MALK_ECOLI -
119 HHSearch 66.7037% -35 - C1 -3FVQ 7.9 FBPC_NEIG1
53 PsiBlast_CBE 62.9535% -30 - C1 -3TIF 6.5 Y796_METJA
118 HHSearch 62.0130% -54 - C1 -4YER 6.0 ?
51 PsiBlast_CBE 61.3635% -30 - C1 -1L2T 6.8 Y796_METJA
52 PsiBlast_CBE 61.3535% -29 - C1 -1L2T 6.7 Y796_METJA
54 PsiBlast_CBE 60.9835% -36 - C1 -3TIF 6.2 Y796_METJA
50 PsiBlast_CBE 60.6334% -48 - C1 -4YMU 5.9 ?
45 PsiBlast_CBE 55.9235% -27 - C1 -4U00 4.3 ?
40 PsiBlast_CBE 54.5934% -18 - C1 -1VCI 3.5 ?
81 PsiBlast_CBE 49.6732% -49 - C1 -2OLK 3.9 ?
71 PsiBlast_CBE 49.0932% -40 - C1 -3C4J 3.5 ?
85 PsiBlast_CBE 49.0233% -50 - C1 -3C41 4.3 ?
79 PsiBlast_CBE 48.8532% -43 - C1 -2OLK 4.0 ?
72 PsiBlast_CBE 48.7732% -43 - C1 -3C4J 5.0 ?
86 PsiBlast_CBE 47.4633% -48 - C1 -3C41 5.5 ?
84 PsiBlast_CBE 47.3132% -43 - C1 -2OLJ 3.9 ?
83 PsiBlast_CBE 46.9332% -37 - C1 -2OLJ 3.8 ?
74 PsiBlast_CBE 46.6632% -46 - C1 -2Q0H 3.4 ?
80 PsiBlast_CBE 46.4932% -44 - C1 -2OLK 4.3 ?
82 PsiBlast_CBE 46.3132% -45 - C1 -2OLK 4.0 ?
103 PsiBlast_CBE 43.0133% -62 - C1 -4HLU 4.1 ECFA1_THEMA
102 PsiBlast_CBE 42.4333% -62 - C1 -4HLU 3.6 ECFA1_THEMA
92 PsiBlast_CBE 33.9731%-112 - C1 -3J15 3.8 ?
91 PsiBlast_CBE 31.5731%-113 - C1 -3BK7 3.8 ?
97 PsiBlast_CBE 18.2631% -3 - C1 -2FFA 4.3
93 PsiBlast_CBE 18.1631% -22 - C1 -2FGJ 4.4
95 PsiBlast_CBE 17.5131% -17 - C1 -2FGJ 5.2 HLYBP_ECOLX
94 PsiBlast_CBE 16.6831% -21 - C1 -2FGJ 5.0 HLYBP_ECOLX
96 PsiBlast_CBE 16.4531% -15 - C1 -2FGJ 5.2 HLYBP_ECOLX
100 PsiBlast_CBE 16.2931% -18 - C1 -1XEF 5.4 HLYBP_ECOLX
101 PsiBlast_CBE 15.8231% -11 - C1 -1XEF 4.8 HLYBP_ECOLX
98 PsiBlast_CBE 13.3531% -19 - C1 -1XEF 4.9
99 PsiBlast_CBE 13.0331% -16 - C1 -1XEF 4.9 HLYBP_ECOLX