@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu30630: (2016-07-20 )
MYEFKDYYQNTVQLSFDDQPFSDSPKHVWVICRFGGKWLLTEHEDRGYEFPGGKVEPMECAEEAALREVKEETGARVKSLKYLGQYKVLGKEKVIVKNIYFADIEKLEKQADYFETKGPVLFHELPENLSRNKKFSFIMKDSVLPISLKKLKESGWIE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GTP_A_3(4JZT)
YTKD_BACSU
[Raw transfer]




NACID_C_3(4JZV)
YTKD_BACSU
[Raw transfer]

-

NACID_C_3(4JZU)
YTKD_BACSU
[Raw transfer]

-

23 PsiBlast_CBE 94.7999% -89 - C3 -4JZS - YTKD_BACSU -
4 PsiBlast_PDB 94.3799% -85 - C3 -4JZS - YTKD_BACSU -
2 PsiBlast_PDB 94.28100% -81 - C3 -4JZV 5.9 YTKD_BACSU
1 PsiBlast_PDB 93.56100% -80 - C3 -4JZU - YTKD_BACSU -
3 PsiBlast_PDB 93.1099% -94 - C3 -4JZT 4.8 YTKD_BACSU
22 PsiBlast_CBE 91.36100% -79 - C3 -4JZU - YTKD_BACSU -
21 PsiBlast_CBE 88.61100% -84 - C3 -4JZV - YTKD_BACSU -
117 HHSearch 85.8190% -53 - C3 -4JZU 6.1 YTKD_BACSU
118 HHSearch 82.2485% -47 - C3 -4JZS - YTKD_BACSU -
130 HHSearch 48.7321% -21 - C3 -3Q1P - ? -
120 HHSearch 48.7018% -31 * C3 *3O8S - ? -
119 HHSearch 43.7224% -17 - C3 -3I7U - ? -
72 PsiBlast_CBE 43.2235% -66 - C2 -3GRN - ? -
114 Fugue 42.4921% -38 - C3 -1K2E - ? -
35 PsiBlast_CBE 42.3437% -47 - C2 -5HZX - ? -
6 PsiBlast_PDB 41.7733% -32 - C2 -1SOI - ? -
9 PsiBlast_PDB 41.4535% -66 - C- -3F13 - ? -
122 HHSearch 41.3124% 10 - C3 -1VK6 - NUDC_ECOLI -
61 PsiBlast_CBE 41.1533% -47 - C2 -4C9W - 8ODP_HUMAN -
58 PsiBlast_CBE 41.1333% -55 - C2 -5ANW - ? -