@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu30670: (2016-07-20 )
MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HYI_A_4(2FQO)
LUXS_BACSU
[Raw transfer]




H1D_A_5(2FQT)
LUXS_BACSU
[Raw transfer]




KRI_A_4(1YCL)
LUXS_BACSU
[Raw transfer]




MET_A_6(1J6X)
LUXS_HELPJ
[Raw transfer]




MET_A_6(1J6W)
LUXS_HAEIN
[Raw transfer]




MET_A_6(1J6X)
LUXS_HELPJ
[Raw transfer]




MET_A_6(1J6W)
LUXS_HAEIN
[Raw transfer]




1 PsiBlast_PDB 87.50100%-138 - C4 -2FQO 3.9 LUXS_BACSU
2 PsiBlast_PDB 87.26100%-137 - C4 -2FQT 3.6 LUXS_BACSU
3 PsiBlast_PDB 86.5199%-141 - C4 -1YCL 2.3 LUXS_BACSU
5 PsiBlast_PDB 66.5243% -94 - C4 -1VH2 - LUXS_DEIRA -
19 HHSearch 66.1247%-119 - C4 -1J6X 2.7 LUXS_HELPJ
7 PsiBlast_PDB 65.8943% -93 - C4 -1J6V - LUXS_DEIRA -
6 PsiBlast_PDB 64.2443% -90 - C4 -1INN - LUXS_DEIRA -
22 HHSearch 64.1538%-108 - C4 -4XCH - ? -
21 HHSearch 63.5337%-113 - C4 -1J6W 4.8 LUXS_HAEIN
13 PsiBlast_CBE 63.0037%-127 - C4 -1JOE - LUXS_HAEIN -
14 PsiBlast_CBE 61.7337%-129 - C4 -1JOE - LUXS_HAEIN -
10 PsiBlast_PDB 61.6536%-121 - C4 -1J6W 4.8 LUXS_HAEIN
8 PsiBlast_PDB 61.0437%-129 - C4 -1JOE - LUXS_HAEIN -
12 PsiBlast_CBE 60.9937%-131 - C4 -1JOE - LUXS_HAEIN -
16 PsiBlast_CBE 60.6940% -19 - C4 -4XCH - ? -
17 PsiBlast_CBE 60.6340% -23 - C4 -4XCH - ? -
15 PsiBlast_CBE 60.5240% -12 - C4 -4XCH - ? -
4 PsiBlast_PDB 60.4045% 14 - C4 -1J6X 2.7 LUXS_HELPJ
9 PsiBlast_PDB 60.2440% -16 - C4 -4XCH - ? -
30 HHSearch 41.4916%-302 - C4 -3BY5 - ? -