@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu30940: (2016-07-21 )
MNHSKTLLLTAAAGLMLTCGAVSSQAKHKLSDPYHFTVNAAAETEPVDTAGDAADDPAIWLDPKTPQNSKLITTNKKSGLVVYSLDGKMLHSYNTGKLNNVDIRYDFPLNGKKVDIAAASNRSEGKNTIEIYAIDGKNGTLQSMTDPDHPIATAINEVYGFTLYHSQKTGKYYAMVTGKEGEFEQYELKADKNGYISGKKVRAFKMNSQTEGMAADDEYGRLYIAEEDEAIWKFSAEPDGGSNGTVIDRADGRHLTRDIEGLTIYYAADGKGYLMASSQGNSSYAIYDRQGKNKYVADFRITDGPETDGTSDTDGIDVLGFGLGPEYPFGIFVAQDGENIDHGQKANQNFKIVPWERIADQIGFRPLANEQVDPRKLTDRSGK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IHS_A_2(3AMS)
PHYC_BACIU
[Raw transfer]




IHS_A_2(3AMR)
PHYC_BACIU
[Raw transfer]




IHS_A_2(3AMR)
PHYC_BACIU
[Raw transfer]




2 PsiBlast_PDB 95.46100% -41 - C2 -3AMS 4.8 PHYC_BACIU
1 PsiBlast_PDB 94.77100% -41 - C2 -3AMR 4.4 PHYC_BACIU
34 Fugue 94.6392% -47 - C2 -1CVM - PHYT_BACSD -
6 PsiBlast_PDB 94.4992% -47 - C2 -1CVM - PHYT_BACSD -
13 HHSearch 94.46100% -39 - C2 -3AMR 4.4 PHYC_BACIU
33 Fugue 94.3892% -42 - C2 -1H6L - PHYT_BACSD -
7 PsiBlast_PDB 94.2592% -42 - C2 -1H6L - PHYT_BACSD -
3 PsiBlast_PDB 93.8592% -41 - C2 -1POO - PHYT_BACSD -
5 PsiBlast_PDB 93.5192% -45 - C2 -1QLG - PHYT_BACSD -
4 PsiBlast_PDB 93.3792% -42 - C2 -2POO - PHYT_BACSD -
42 Fugue 34.3910% 11 - C2 -1IJQ - LDLR_HUMAN -
35 Fugue 32.9113% 24 - C2 -1Q7F - BRAT_DROME -
29 HHSearch 31.5218% -62 - C2 -1PBY - ? -
38 Fugue 29.799% 14 - C2 -2QXV - EED_MOUSE -
41 Fugue 29.0423% -25 - C3 -2JTD - -
36 Fugue 28.5010% 35 - C2 -1RI6 - 6PGL_ECOLI -
16 HHSearch 28.396% -28 - C2 -5I5M - ? -
30 HHSearch 28.1115% -16 - C2 -3M0C - LDLR_HUMAN -
18 HHSearch 25.2215% -15 - C2 -1N7D - LDLR_HUMAN -
26 HHSearch 24.9114% -8 - C2 -3V64 - LRP4_RAT -