@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu30990: (2016-07-21 )
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVSKTKGKLIVSVVSAVFIGSLLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BNG_A_4(3RLB)
?
[Raw transfer]




BNG_A_6(3RLB)
?
[Raw transfer]




BNG_A_6(3RLB)
?
[Raw transfer]




15 PsiBlast_CBE 94.8232%-209 - C6 -4MHW - ? -
8 PsiBlast_PDB 93.8732%-216 - C6 -4POV - THIT_LACLM -
13 PsiBlast_CBE 93.8332%-212 - C6 -4POP - THIT_LACLM -
4 PsiBlast_PDB 93.8232%-210 - C6 -3RLB - ? -
14 PsiBlast_CBE 93.7632%-212 - C6 -4MUU - ? -
5 PsiBlast_PDB 93.5632%-213 - C6 -4MHW - ? -
3 PsiBlast_PDB 93.1332%-215 - C6 -4N4D - ? -
11 PsiBlast_CBE 92.3532%-216 - C6 -4MES - ? -
6 PsiBlast_PDB 92.3232%-211 - C6 -4MUU - ? -
10 PsiBlast_CBE 92.0132%-216 - C6 -4N4D - ? -
2 PsiBlast_PDB 91.5632%-215 - C6 -4MES - ? -
7 PsiBlast_PDB 91.3632%-211 - C6 -4POP - THIT_LACLM -
27 Fugue 90.9531%-193 - C6 -3RLB 2.7 ?
16 PsiBlast_CBE 90.9532%-216 - C6 -3RLB 3.4 ?
12 PsiBlast_CBE 90.4332%-213 - C6 -4POV - THIT_LACLM -
18 HHSearch 89.2030%-196 - C6 -3RLB 2.7 ?
17 HHSearch 88.4930%-188 - C6 -4TKR - ? -
1 PsiBlast_PDB 88.3330%-194 - C6 -4TKR - ? -
21 HHSearch 63.9920%-207 - C6 -4HZU - ? -
24 HHSearch 59.2718%-164 - C6 -4RFS - ? -