@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu31000: (2016-07-21 )
MVTVREAKLEDIKDIAKVHVDSWRTTYHEIIPIDYLNSLNYKEFEDKWKSRSLKGVFVAQDEKGSVFGFASFGPIRSEQEGYDGELYAIYLLEERQRQGAGRALLAKGAEFLLQHGFSSMFVWVIEQNPSIIFYQAYSPERVAEDNFEIAGVRLKEVGLGWPDLSALKTLLNR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACO_A_2(2CY2)
?
[Raw transfer]




ACO_A_2(2CY2)
?
[Raw transfer]




EDO_A_9(3FNC)
?
[Raw transfer]




MES_A_4(1WK4)
?
[Raw transfer]




EDO_A_8(3FNC)
?
[Raw transfer]




2 PsiBlast_PDB 85.4340% 7 - C1 -2CY2 9.5 ?
30 HHSearch 84.4341% 2 - C1 -2CY2 10.0 ?
1 PsiBlast_PDB 83.4940% 6 - C1 -1WK4 3.2 ?
51 Fugue 80.6738% 7 - C1 -2CY2 - ? -
35 HHSearch 63.8830% -59 - C1 -3FNC 3.1 ?
6 PsiBlast_PDB 62.6425% -19 - C1 -2J8R - MDDA_PSEA7 -
5 PsiBlast_PDB 62.3925% -16 - C1 -2J8N - MDDA_PSEA7 -
4 PsiBlast_PDB 61.7325% -19 - C1 -2J8M - MDDA_PSEA7 -
3 PsiBlast_PDB 59.0231% -62 - C1 -3FNC - ? -
46 HHSearch 55.5822% -28 - C1 -3DR6 - MDDA_SALTY -
38 HHSearch 54.7319% -75 - C1 -2AE6 - ? -
50 HHSearch 54.4919% -34 - C1 -5DWM - ? -
56 Fugue 54.1222% -68 - C1 -2BEI - SAT2_HUMAN -
11 PsiBlast_PDB 53.7825% -2 - C1 -4JXR - ? -
58 Fugue 53.7320% 24 - C1 -2KCW - YJAB_ECOLI -
10 PsiBlast_PDB 53.6125% -3 - C1 -4JXQ - ? -
37 HHSearch 53.3219% -24 - C1 -1U6M - ? -
42 HHSearch 52.9814% -18 - C1 -1GHE - TTR_PSEAJ -
36 HHSearch 52.8923% -38 - C1 -2B5G - SAT1_HUMAN -
44 HHSearch 52.8819% -86 - C1 -2FE7 - ? -