@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu31140: (2016-07-21 )
MELYECIQDIFGGLKNPSVKDLATSLKQIPNAAKLSQPYIKEPDQYAYGRNAIYRNNELEIIVINIPPNKETTVHDHGQSIGCAMVLEGKLLNSIYRSTGEHAELSNSYFVHEGECLISTKGLIHKMSNPTSERMVSLHVYSPPLEDMTVFEEQKEVLENS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CYS_A_4(4QM9)
CDOA_BACSU
[Raw transfer]




CYS_B_6(4QM9)
CDOA_BACSU
[Raw transfer]




CYS_A_4(4QM9)
CDOA_BACSU
[Raw transfer]




1 PsiBlast_PDB 97.97100%-104 - C1 -4QM9 3.6 CDOA_BACSU
21 PsiBlast_CBE 97.84100%-108 - C1 -4QM9 3.3 CDOA_BACSU
3 PsiBlast_PDB 93.5297% -97 - C1 -4QM8 - CDOA_BACSU -
2 PsiBlast_PDB 93.2397% -96 - C1 -3EQE - CDOA_BACSU -
33 HHSearch 90.3297% -52 - C1 -4QM9 3.6 CDOA_BACSU
32 HHSearch 54.6020% -17 - C1 -4IEU - CDO1_RAT -
34 HHSearch 44.6417% 7 - C1 -4WVZ - ? -
35 HHSearch 43.9818% 14 - C1 -4QMA - ? -
44 HHSearch 41.7521%-101 - C- -3FJS - ? -
25 Fugue 41.4418% 25 - C1 -3USS - ? -
23 Fugue 41.3420% 78 - C1 -2ATF - CDO1_MOUSE -
51 HHSearch 40.8323% -73 * C1 *4E2G - ? -
37 HHSearch 40.6017% -86 - C1 -1V70 - ? -
48 HHSearch 38.4918% -92 - C1 -1DGW - ? -
9 PsiBlast_PDB 38.3025% 18 - C1 -4XFG - ? -
14 PsiBlast_PDB 37.9825% 14 - C1 -2GH2 - CDO1_RAT -
10 PsiBlast_PDB 37.9825% 18 - C1 -4XF0 - ? -
11 PsiBlast_PDB 37.9525% 14 - C1 -2IC1 - CDO1_HUMAN -
6 PsiBlast_PDB 37.4025% 20 - C1 -4PIY - ? -
12 PsiBlast_PDB 37.3925% 15 - C1 -4YNI - ? -