Study : bsu31360 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C3_S1
Best Complexes choosen after comparative docking [pKd > 3] : 3 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C3_S1
Complex: NAP_B_6(1VLJ) / Model_21(1VLJ/B) = [10.5] Download1618.1623.28MENFTYYNPTKLIFGKGQLEQLRKEFKRYGKNVLLVYGGGSIKRNGLYDQVTGILKEEGAVVHELSGVEPNPRLATVEKGIGLCREHDIDFLLAVGGGSVIDCTKAIAAGVKYDGDAWDIFSKKVTAEDALPFGTVLTLAATGSEMNPDSVITNWETNEKFVWGSNVTHPRFSILDPENTFTVPENQTVYGMVDMMSHVFEQYFHNVENTPLQDRMCFAVLQTVIETAPKLLEDLENYELRETILYAGTIALNGTLQMGYFGDWASHTMEHAVSAVYDIPHAGGLAILFPNWMRYTLDTNVGRFKNLMLNMFDIDTEGKTDKEIALEGIDKLSAFWTSLGAPSRLADYNIGEEKLELIADIAAKEMEHGGFGNFQKLNKDDVLAILRASL
Complex: NAP_A_5(1VLJ) / Model_40(1VLJ/A) = [11.5] Download1465.3325.90MENFTYYNPTKLIFGKGQLEQLRKEFKRYGKNVLLVYGGGSIKRNGLYDQVTGILKEEGAVVHELSGVEPNPRLATVEKGIGLCREHDIDFLLAVGGGSVIDCTKAIAAGVKYDGDAWDIFSKKVTAEDALPFGTVLTLAATGSEMNPDSVITNWETNEKFVWGSNVTHPRFSILDPENTFTVPENQTVYGMVDMMSHVFEQYFHNVENTPLQDRMCFAVLQTVIETAPKLLEDLENYELRETILYAGTIALNGTLQMGYFGDWASHTMEHAVSAVYDIPHAGGLAILFPNWMRYTLDTNVGRFKNLMLNMFDIDTEGKTDKEIALEGIDKLSAFWTSLGAPSRLADYNIGEEKLELIADIAAKEMEHGGFGNFQKLNKDDVLAILRASL
Complex: NAP_A_5(1VLJ) / Model_1(1VLJ/A) = [11.5] Download1623.5125.90MENFTYYNPTKLIFGKGQLEQLRKEFKRYGKNVLLVYGGGSIKRNGLYDQVTGILKEEGAVVHELSGVEPNPRLATVEKGIGLCREHDIDFLLAVGGGSVIDCTKAIAAGVKYDGDAWDIFSKKVTAEDALPFGTVLTLAATGSEMNPDSVITNWETNEKFVWGSNVTHPRFSILDPENTFTVPENQTVYGMVDMMSHVFEQYFHNVENTPLQDRMCFAVLQTVIETAPKLLEDLENYELRETILYAGTIALNGTLQMGYFGDWASHTMEHAVSAVYDIPHAGGLAILFPNWMRYTLDTNVGRFKNLMLNMFDIDTEGKTDKEIALEGIDKLSAFWTSLGAPSRLADYNIGEEKLELIADIAAKEMEHGGFGNFQKLNKDDVLAILRASL
Consensus
[pKd Mean = 11.17]
-1569
(s=73)
25
(s=1)
MENFTYYNPTKLIFGKGQLEQLRKEFKRYGKNVLLVYGGGSIKRNGLYDQVTGILKEEGAVVHELSGVEPNPRLATVEKGIGLCREHDIDFLLAVGGGSVIDCTKAIAAGVKYDGDAWDIFSKKVTAEDALPFGTVLTLAATGSEMNPDSVITNWETNEKFVWGSNVTHPRFSILDPENTFTVPENQTVYGMVDMMSHVFEQYFHNVENTPLQDRMCFAVLQTVIETAPKLLEDLENYELRETILYAGTIALNGTLQMGYFGDWASHTMEHAVSAVYDIPHAGGLAILFPNWMRYTLDTNVGRFKNLMLNMFDIDTEGKTDKEIALEGIDKLSAFWTSLGAPSRLADYNIGEEKLELIADIAAKEMEHGGFGNFQKLNKDDVLAILRASL