@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu31360: (2016-07-22 )
MENFTYYNPTKLIFGKGQLEQLRKEFKRYGKNVLLVYGGGSIKRNGLYDQVTGILKEEGAVVHELSGVEPNPRLATVEKGIGLCREHDIDFLLAVGGGSVIDCTKAIAAGVKYDGDAWDIFSKKVTAEDALPFGTVLTLAATGSEMNPDSVITNWETNEKFVWGSNVTHPRFSILDPENTFTVPENQTVYGMVDMMSHVFEQYFHNVENTPLQDRMCFAVLQTVIETAPKLLEDLENYELRETILYAGTIALNGTLQMGYFGDWASHTMEHAVSAVYDIPHAGGLAILFPNWMRYTLDTNVGRFKNLMLNMFDIDTEGKTDKEIALEGIDKLSAFWTSLGAPSRLADYNIGEEKLELIADIAAKEMEHGGFGNFQKLNKDDVLAILRASL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_A_5(1VLJ)
?
[Raw transfer]




NAP_B_6(1VLJ)
?
[Raw transfer]




NAP_A_5(1VLJ)
?
[Raw transfer]




40 HHSearch 83.8141% -20 - C3 -1VLJ 11.5 ?
21 PsiBlast_CBE 83.7141% -9 - C3 -1VLJ 10.5 ?
1 PsiBlast_PDB 83.4241% -11 - C3 -1VLJ 11.5 ?
23 PsiBlast_CBE 82.5338% -45 - C3 -1OJ7 - YQHD_ECOLI -
2 PsiBlast_PDB 81.5138% -38 - C3 -1OJ7 - YQHD_ECOLI -
22 PsiBlast_CBE 81.4638% -39 - C3 -1OJ7 - YQHD_ECOLI -
24 PsiBlast_CBE 80.7038% -36 - C3 -1OJ7 - YQHD_ECOLI -
3 PsiBlast_PDB 77.9828% -88 - C3 -3OWO - ADH2_ZYMMO -
4 PsiBlast_PDB 77.3128% -83 - C3 -3OX4 - ADH2_ZYMMO -
38 HHSearch 72.3028% -18 - C3 -3BFJ - DHAT_KLEPN -
5 PsiBlast_PDB 72.2528% -15 - C3 -3BFJ - DHAT_KLEPN -
25 Fugue 71.8134% 25 - C3 -1OJ7 - YQHD_ECOLI -
36 HHSearch 70.3426% -17 * C3 *3OX4 - ADH2_ZYMMO -
35 HHSearch 68.1024% -23 - C3 -5BR4 - FUCO_ECOLI -
13 PsiBlast_PDB 68.0724% -44 - C3 -1RRM - FUCO_ECOLI -
50 HHSearch 65.3921% -81 - C3 -4MCA - ? -
37 HHSearch 64.8526% 3 - C3 -4FR2 - ? -
11 PsiBlast_PDB 64.2924% -29 - C3 -2BI4 - FUCO_ECOLI -
42 HHSearch 63.5826% -38 - C3 -1O2D - ? -
12 PsiBlast_PDB 63.3224% -30 - C3 -2BL4 - FUCO_ECOLI -