@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu31840: (2016-07-23 )
MELYIITGASKGLGQAIALQALEKGHEVHALSRTKTDVSHKKLTQHQIDLINLEEAEQQFETLLSSIDSDRYSGITLINNAGMVTPIKRAGEASLDELQRHYQLNLTAPVLLSQLFTKRFASYSGKKTVVNITSGAAKNPYKGWSAYCSSKAGLDMFTRTFGFEQEDEELPVNMISFSPGVMDTEMQAVIRSSSKKDFHHIERFRKLNETGSLRSPDFIAGTLLSLLEKGTENGRIYDIKEFL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MPD_A_21(4H15)
?
[Raw transfer]




1 PsiBlast_PDB 74.1332% 24 - C2 -1NAS - SPRE_MOUSE -
3 PsiBlast_PDB 73.5433% 23 - C2 -1SEP - SPRE_MOUSE -
2 PsiBlast_PDB 71.1832% 26 - C2 -1OAA - SPRE_MOUSE -
54 HHSearch 66.6325% -33 - C2 -2D1Y - ? -
46 HHSearch 66.5523% 9 - C2 -4G81 - ? -
47 HHSearch 64.7218%-118 - C2 -1O5I - ? -
57 HHSearch 62.3324% -15 - C2 -4HP8 - ? -
42 HHSearch 62.1619% -5 - C2 -2AG5 - BDH2_HUMAN -
59 HHSearch 61.9320% 11 - C2 -3WDS - ? -
49 HHSearch 61.2920% -76 - C2 -1FJH - DIDH_COMTE -
43 HHSearch 60.5621% -18 - C2 -3GED - ? -
56 HHSearch 60.4720% -15 - C2 -4XGN - ? -
50 HHSearch 60.2623% -12 - C2 -3D3W - DCXR_HUMAN -
48 HHSearch 60.2521% -17 - C2 -3TZQ - ? -
51 HHSearch 59.7520% -24 - C2 -2CFC - HCDR_XANP2 -
41 HHSearch 59.0220% -21 * C2 *4ZA2 - ? -
44 HHSearch 58.4222% -35 - C2 -4H15 4.3 ?
53 HHSearch 55.9520% 12 - C2 -3O38 - ? -
58 HHSearch 55.8320% 35 - C2 -3N74 - ? -
55 HHSearch 55.0019% -12 - C2 -1MXH - ? -