@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu32000: (2016-07-23 )
MNAKGIEGKIAFITGAAQGIGEAVARTLASQGAHIAAVDYNPEKLEKVVSSLKAEGRHAEAFPADVRDSAAIDEITARIEREMGPIDILVNVAGVLRPGLIHSLSDEEWEATFSVNSTGVFNASRSVSKYMMDRRSGSIVTVGSNAAGVPRTSMAAYASSKAAAVMFTKCLGLELAEYNIRCNIVSPGSTETDMQWSLWADENGAEQVIKGSLETFKTGIPLKKLAKPSDIADAVLFLVSGQAGHITMHNLCVDGGATLGV

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAI_A_5(4NBU)
?
[Raw transfer]




NAI_C_8(4NBU)
?
[Raw transfer]




EDO_B_22(3RRO)
FABG_VIBCH
[Raw transfer]




EDO_A_10(3RRO)
FABG_VIBCH
[Raw transfer]




EDO_A_11(3RRO)
FABG_VIBCH
[Raw transfer]




EDO_A_7(4I08)
FABG_VIBCH
[Raw transfer]




2 PsiBlast_PDB 83.2337%-102 - C- -3ENN - ? -
112 HHSearch 83.1032%-104 - C1 -4J2H - ? -
124 HHSearch 82.7832%-107 - C1 -1FMC - HDHA_ECOLI -
88 PsiBlast_CBE 80.6432% -22 - C1 -3S55 - ? -
15 PsiBlast_PDB 77.8131% -98 - C1 -2C07 - ? -
21 PsiBlast_CBE 76.6536%-106 - C1 -1Q7B - FABG_ECOLI -
61 PsiBlast_CBE 76.6333% -65 - C1 -3QRW - ACT3_STRCO -
92 PsiBlast_CBE 76.4432% -24 - C1 -3S55 - ? -
90 PsiBlast_CBE 76.1832% -27 - C1 -3S55 - ? -
66 PsiBlast_CBE 75.3733% -73 - C1 -2RHR - ACT3_STRCO -
91 PsiBlast_CBE 75.3332% -24 - C1 -3S55 - ? -
11 PsiBlast_PDB 75.2634% -97 - C1 -3FTP - ? -
87 PsiBlast_CBE 74.7932%-103 - C1 -3O03 - ? -
22 PsiBlast_CBE 74.7636%-106 - C1 -1Q7B - FABG_ECOLI -
79 PsiBlast_CBE 74.6433% -69 - C1 -2RH4 - ACT3_STRCO -
68 PsiBlast_CBE 74.6433% -69 - C1 -4DBZ - ACT3_STRCO -
76 PsiBlast_CBE 74.5733% -71 - C1 -1W4Z - ACT3_STRCO -
93 PsiBlast_CBE 74.4732% -27 - C1 -3S55 - ? -
4 PsiBlast_PDB 74.3336%-100 - C1 -1Q7B - FABG_ECOLI -
75 PsiBlast_CBE 74.1533% -56 - C1 -1W4Z - ACT3_STRCO -
14 PsiBlast_PDB 70.1834%-102 - C1 -4I08 3.0 FABG_VIBCH
35 PsiBlast_CBE 67.1134%-101 - C1 -3RRO 2.6 FABG_VIBCH
13 PsiBlast_PDB 66.7834% -98 - C1 -3RRO 3.0 FABG_VIBCH
50 PsiBlast_CBE 61.4932% -19 - C1 -4NBU 8.2 ?
52 PsiBlast_CBE 59.7632% -17 - C1 -4NBU 10.9 ?