@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu32130: (2016-07-23 )
MENVFDYEDIQLIPAKCIVNSRSECDTSVRLGGHTFKLPVVPANMQTIIDEKLAISLAENGYFYVMHRFEPETRIDFIKDMNARGLFSSISVGVKDEEYEFVRQLAEENLTPEYVTIDIAHGHSNAVIEMIQHLKKHLPDSFVIAGNVGTPEAVRELENAGADATKVGIGPGKVCITKIKTGFGTGGWQLAALRWCAKAASKPIIADGGIRTHGDIAKSIRFGATMVMIGSLFAGHEESPGQTIEKDGKLYKEYFGSASEFQKGEKKNVEGKKMHVAHKGSIKDTLIEMEQDLQSSISYAGGTKLNAIRNVDYVIVKNSIFNGDKY

Atome Classification :

(41 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_A_4(4X3Z)
?
[Raw transfer]




NAJ_A_4(4QNE)
?
[Raw transfer]




NAD_A_4(4X3Z)
?
[Raw transfer]




NAD_B_8(4X3Z)
?
[Raw transfer]




NAJ_B_7(4QNE)
?
[Raw transfer]




IMP_A_2(1ZFJ)
IMDH_STRPY
[Raw transfer]




IMP_B_6(4IX2)
?
[Raw transfer]




IMP_A_2(4R7J)
?
[Raw transfer]




IMP_C_8(4IX2)
?
[Raw transfer]




IMP_D_11(4IX2)
?
[Raw transfer]




39H_A_6(4QM1)
?
[Raw transfer]




IMP_B_6(4FO4)
?
[Raw transfer]




Q21_B_18(4MY8)
?
[Raw transfer]




XMP_A_2(4ZQM)
IMDH_MYCTU
[Raw transfer]




FMT_B_12(4FEZ)
?
[Raw transfer]




FMT_A_7(4FEZ)
?
[Raw transfer]




XMP_A_2(4QQ3)
?
[Raw transfer]




Q21_B_13(4MY8)
?
[Raw transfer]




RVP_A_4(1ME8)
IMDH_TRIFO
[Raw transfer]




2EY_B_8(4MYA)
?
[Raw transfer]




39H_C_10(4QM1)
?
[Raw transfer]




2EY_A_4(4MYA)
?
[Raw transfer]




39H_B_8(4QM1)
?
[Raw transfer]




IMP_A_3(3USB)
?
[Raw transfer]




IMP_A_2(5AHN)
?
[Raw transfer]




1 PsiBlast_PDB 99.0188%-105 - C2 -2A1Y - GUAC_BACAN -
11 PsiBlast_PDB 64.4934% -26 - C2 -4MYX - ? -
96 PsiBlast_CBE 63.9233% -4 - C2 -4QJ1 - ? -
95 PsiBlast_CBE 63.8933% -10 - C2 -4QJ1 - ? -
116 HHSearch 63.3833% -9 - C2 -3R2G - ? -
48 PsiBlast_CBE 63.1634% -24 - C2 -4QM1 4.5 ?
93 PsiBlast_CBE 63.1233% -10 - C2 -4QJ1 - ? -
113 HHSearch 63.0833% -10 - C2 -4MYA 2.1 ?
94 PsiBlast_CBE 63.0133% -10 - C2 -4QJ1 - ? -
98 PsiBlast_CBE 62.5333% -10 - C2 -4IXH - IMDH_CRYPV -
69 PsiBlast_CBE 62.4634% -28 - C2 -4MY1 - ? -
63 PsiBlast_CBE 62.4534% -27 - C2 -4MY9 - ? -
10 PsiBlast_PDB 62.3134% -20 - C2 -4MY9 - ? -
73 PsiBlast_CBE 62.1634% -23 - C2 -4MY1 - ? -
55 PsiBlast_CBE 62.0734% -24 - C2 -4MYX - ? -
68 PsiBlast_CBE 62.0634% -21 - C2 -4MY1 - ? -
46 PsiBlast_CBE 62.0534% -27 - C2 -4QM1 3.9 ?
50 PsiBlast_CBE 61.9734% -26 - C2 -4MYX - ? -
91 PsiBlast_CBE 61.8233% -3 - C2 -3KHJ - ? -
90 PsiBlast_CBE 61.8233% -10 - C2 -3KHJ - ? -
56 PsiBlast_CBE 61.6534% -22 - C2 -4MYA 3.6 ?
66 PsiBlast_CBE 61.5234% -24 - C2 -4MY8 3.4 ?
107 HHSearch 61.2331% -3 - C2 -4ZQM 6.2 IMDH_MYCTU
65 PsiBlast_CBE 60.6234% -26 - C2 -4MY8 3.5 ?
47 PsiBlast_CBE 60.5734% -23 - C2 -4QM1 4.2 ?
81 PsiBlast_CBE 59.8234% -6 - C2 -4IX2 4.5 ?
80 PsiBlast_CBE 59.7834% -13 - C2 -4IX2 5.5 ?
79 PsiBlast_CBE 59.4934% -8 - C2 -4IX2 5.4 ?
82 PsiBlast_CBE 59.0934% -2 - C2 -4FO4 5.4 ?
18 PsiBlast_PDB 58.8434% -7 - C2 -4QNE 0.6 ?
19 PsiBlast_PDB 58.4534% -3 - C2 -4X3Z 2.8 ?
17 PsiBlast_PDB 57.8334% -13 - C2 -4QQ3 6.4 ?
78 PsiBlast_CBE 57.0434% -3 - C2 -4QNE 1.3 ?
120 HHSearch 57.0032% -10 - C2 -3USB 4.4 ?
77 PsiBlast_CBE 57.0034% -1 - C2 -4X3Z 2.5 ?
122 HHSearch 55.5635% 16 - C2 -1ZFJ 4.1 IMDH_STRPY
108 HHSearch 55.4134% 12 - C2 -4X3Z 5.5 ?
114 HHSearch 54.2634% 6 - C2 -4R7J 5.9 ?
126 HHSearch 54.1835% -19 * C2 *5AHN 4.7 ?
84 PsiBlast_CBE 52.6633% 14 - C2 -4FEZ 3.2 ?
83 PsiBlast_CBE 51.7533% 20 - C2 -4FEZ 3.1 ?