@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu32150: (2016-07-23 )
MSVKMKKCSREDLQTLQQLSIETFNDTFKEQNSPENMKAYLESAFNTEQLEKELSNMSSQFFFIYFDHEIAGYVKVNIDDAQSEEMGAESLEIERIYIKNSFQKHGLGKHLLNKAIEIALERNKKNIWLGVWEKNENAIAFYKKMGFVQTGAHSFYMGDEEQTDLIMAKTLI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

COA_A_5(1TIQ)
PAIA_BACSU
[Raw transfer]




COA_A_5(1TIQ)
PAIA_BACSU
[Raw transfer]




57 HHSearch 82.10100%-113 - C2 -1TIQ 3.4 PAIA_BACSU
1 PsiBlast_PDB 81.2095%-114 * C2 *1TIQ 3.4 PAIA_BACSU
58 HHSearch 57.9836%-122 - C2 -4E2A - ? -
2 PsiBlast_PDB 57.3036%-124 - C2 -4E2A - ? -
59 HHSearch 55.1822%-139 - C2 -3FNC - ? -
39 PsiBlast_CBE 52.7437%-287 - C2 -4UA3 - YJQ4_SCHPO -
3 PsiBlast_PDB 51.2626% -36 - C2 -3K9U - PAIA_THEAC -
68 HHSearch 50.9127% -20 - C2 -3FIX - PAIA_THEAC -
4 PsiBlast_PDB 49.6426% -28 - C2 -3FIX - PAIA_THEAC -
38 PsiBlast_CBE 49.3937%-283 - C2 -4UA3 - YJQ4_SCHPO -
6 PsiBlast_PDB 49.2926% -36 - C2 -3F0A - PAIA_THEAC -
41 PsiBlast_CBE 48.4735%-284 - C2 -1I12 - GNA1_YEAST -
43 PsiBlast_CBE 48.4535%-278 - C2 -1I12 - GNA1_YEAST -
5 PsiBlast_PDB 48.4226% -31 - C2 -3NE7 - PAIA_THEAC -
65 HHSearch 47.6416% -6 - C2 -1GHE - TTR_PSEAJ -
46 PsiBlast_CBE 47.6335%-287 - C2 -1I1D - GNA1_YEAST -
75 HHSearch 47.3819%-126 - C2 -1Z4E - ? -
40 PsiBlast_CBE 47.2335%-288 - C2 -1I12 - GNA1_YEAST -
77 HHSearch 47.0219%-139 - C2 -2AE6 - ? -
60 HHSearch 46.5217%-151 - C2 -2DXQ - ? -