@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu32240: (2016-07-23 )
MNEADMLFSVTVPGSTANLGPGFDSVGMALSRYLKLTVFESDKWSFEAETETVAGIPAGTDNLIYQVAKRTADLYGKEMPPVHVKVWSDIPLARGLGSSAAAIVAAIELADELCGLKLSEADKLHLASLEEGHPDNAGASLVGGLVIGLHEDDETQMIRVPNADIDVVVVIPFYEVLTRDARDVLPKEFPYADAVKASAVSNILIAAIMSKDWPLVGKIMKKDMFHQPYRAMLVPELSKVEHVAEMKGAYGTALSGAGPTILVMTEKGKGEELKEQLALHFPHCEVDALTVPKEGSIIERNPLYQVKSV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

THR_A_2(1H73)
KHSE_METJA
[Raw transfer]



ILE_A_5(1H74)
KHSE_METJA
[Raw transfer]



DIO_C_3(1KKH)
MVK_METJA
[Raw transfer]
1 PsiBlast_PDB 79.5041% -53 - C1 -3HUL - KHSE_LISMO -
29 HHSearch 77.9941% -43 - C1 -3HUL - KHSE_LISMO -
21 PsiBlast_CBE 77.8441% -42 - C1 -3HUL - KHSE_LISMO -
31 HHSearch 70.3827% 2 * C1 *4RPF - KHSE_YERPN -
32 HHSearch 70.3327% 13 - C1 -1H72 - KHSE_METJA -
55 Fugue 69.7226% -12 - C1 -1H72 - KHSE_METJA -
54 Fugue 69.1326% 8 - C1 -1FWK - KHSE_METJA -
52 Fugue 68.6925% 5 - C1 -1H72 - KHSE_METJA -
6 PsiBlast_PDB 68.2827% 23 - C1 -1H72 - KHSE_METJA -
8 PsiBlast_PDB 68.1927% 20 - C1 -1H73 3.2 KHSE_METJA
2 PsiBlast_PDB 67.4526% -0 - C1 -4RPF - KHSE_YERPN -
5 PsiBlast_PDB 67.3827% 19 - C1 -1FWL - KHSE_METJA -
7 PsiBlast_PDB 67.3527% 19 - C1 -1H74 5.1 KHSE_METJA
53 Fugue 67.2625% 7 - C1 -1H74 - KHSE_METJA -
4 PsiBlast_PDB 67.1227% 22 - C1 -1FWK - KHSE_METJA -
16 PsiBlast_PDB 63.0223% -67 - C1 -3PYG - ISPE_MYCTU -
15 PsiBlast_PDB 62.4523% -64 - C1 -3PYF - ISPE_MYCTU -
14 PsiBlast_PDB 61.1523% -67 - C1 -3PYE - ISPE_MYCTU -
13 PsiBlast_PDB 60.8523% -66 - C1 -3PYD - ISPE_MYCTU -
48 HHSearch 60.7122% 7 - C1 -2CZ9 - GAL1_PYRHO -