@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu32250: (2016-07-23 )
MWKGLIHQYKEFLPVTDQTPALTLHEGNTPLIHLPKLSEQLGIELHVKTEGVNPTGSFKDRGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARANMKCIVIIPNGKIAFGKLAQAVMYGAEIIAIDGNFDDALKIVRSICEKSPIALVNSVNPYRIEGQKTAAFEVCEQLGEAPDVLAIPVGNAGNITAYWKGFKEYHEKNGTGLPKMRGFEAEGAAAIVRNEVIENPETIATAIRIGNPASWDKAVKAAEESNGKIDEVTDDEILHAYQLIARVEGVFAEPGSCASIAGVLKQVKSGEIPKGSKVVAVLTGNGLKDPNTAVDISEIKPVTLPTDEDSILEYVKGAARV

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AN7_A_3(3AEX)
?
[Raw transfer]




AN7_B_5(3AEX)
?
[Raw transfer]




PLP_A_3(2D1F)
THRC_MYCTU
[Raw transfer]




PLP_A_3(2D1F)
THRC_MYCTU
[Raw transfer]




PLP_B_4(2D1F)
THRC_MYCTU
[Raw transfer]




PLP_A_3(1UIM)
?
[Raw transfer]




PLP_B_4(1UIM)
?
[Raw transfer]




PLP_A_6(1UIN)
?
[Raw transfer]




PLP_B_7(1UIN)
?
[Raw transfer]




2 PsiBlast_PDB 84.9961% -32 - C2 -2D1F 4.5 THRC_MYCTU
78 HHSearch 84.8058% -27 - C2 -2D1F 4.5 THRC_MYCTU
1 PsiBlast_PDB 84.7060% -1 * C2 *2ZSJ - ? -
80 HHSearch 84.4561% -3 - C2 -2ZSJ - ? -
22 PsiBlast_CBE 84.0860% -1 - C2 -2ZSJ - ? -
24 PsiBlast_CBE 84.0161% -31 - C2 -2D1F 5.6 THRC_MYCTU
21 PsiBlast_CBE 83.8360% -2 - C2 -2ZSJ - ? -
23 PsiBlast_CBE 83.5860% -1 - C2 -2ZSJ - ? -
79 HHSearch 75.8454% -0 - C2 -3AEY - ? -
27 PsiBlast_CBE 75.6155% 4 - C2 -1V7C - ? -
25 PsiBlast_CBE 75.4455% 1 - C2 -3AEY - ? -
3 PsiBlast_PDB 75.1855% 4 - C2 -1UIM 4.3 ?
28 PsiBlast_CBE 74.6355% 7 - C2 -1V7C - ? -
7 PsiBlast_PDB 74.3655% 1 - C2 -3AEY - ? -
5 PsiBlast_PDB 74.0955% 7 - C2 -1V7C - ? -
26 PsiBlast_CBE 73.7855% 6 - C2 -3AEX 6.1 ?
4 PsiBlast_PDB 73.2255% 4 - C2 -1UIN 4.1 ?
6 PsiBlast_PDB 73.1755% 7 - C2 -3AEX 6.5 ?
29 PsiBlast_CBE 72.9355% 4 - C2 -1V7C - ? -
30 PsiBlast_CBE 72.4055% 2 - C2 -1UIN 4.1 ?
31 PsiBlast_CBE 72.2355% 2 - C2 -1UIM 4.0 ?